ࡱ> 86       !!""##$%%%&&''(())**++,,--..//001122334455 1  !"#$%&()*+,-./0X234567EI:;<=>?@ABCDXFWHJKLVOPQRSTUGZYb[\]^_`adcefghijklmnopqrstuvwxyz{|}~Root Entry F ڵ9kSummaryInformation(?L@H?CAED1HN@H?dA/B6H VN@H?;C8DE EX@H??wElDj>D/H'/@H??wElDj;E$H f@HA0C;;B&F7BB4FhD&B I6nstallFilesInstallValidateInstallInitializeInstallFinalizeISSCHEDULEREBOOTScheduleRebootSetupCompleteErrorSetupInterruptedSetupCompleteSuccessSetupInitializationSetupProgressExecuteActionAdminWelcomeCreateShortcutsPublishComponentsPublishFeaturesPublishProductRegisterClassInfoRegisterExtensionInfoRegisterMIMEInfoRegisterProgIdInfoRegisterTypeLibrariesMsiPublishAssembliesAPPS_TESTCCP_TESTVersionNT >= 500setAllUsersProfile2KVersionNT = 400SetAllUsersProfileNTVersionNTsetUserProfileNTNOT InstalledAllocateRegistrySpaceCreateFoldersDeleteServicesDuplicateFilesInstallODBCInstallServicesLaunchConditionsMoveFilesPatchFilesProcessComponentsRegisterFontsRegisterProductRegisterUserRemoveDuplicateFilesRemoveEnvironmentStringsRemoveFilesRemoveFoldersRemoveIniValuesRemoveODBCRemoveRegistryValuesRemoveShortcutsNot CCP_SUCCESS And CCP_TESTRMCCPSearchSelfRegModulesSelfUnregModulesSetODBCFoldersStartServicesStopServicesUnpublishComponentsUnpublishFeaturesUnregisterClassInfoUnregisterExtensionInfoUnregisterFontsUnregisterMIMEInfoUnregisterProgIdInfoUnregisterTypeLibrariesWriteEnvironmentStringsWriteIniValuesWriteRegistryValuesRegisterComPlusUnregisterComPlusValidateProductIDISUnSelfRegisterFilesISSelfRegisterFilesISSelfRegisterCostingISSelfRegisterFinalizeMsiUnpublishAssembliesNot UITEST And Installed And (RESUME Or Preselected)SetupResumeNot UITEST And Installed And Not RESUME And Not PreselectedMaintenanceWelcomeNot UITESTNot UITEST And Not InstalledInstallWelcome.:ALLUSE~1|All UsersTARGETDIRALLUSERSPROFILE.:Admint~1|AdminToolsAdminToolsFolder.:APPLIC~1|Application DataAppDataFolderCENTRE~1|CentreWare Font Management UtilityXEROXCENTREWARE_FONT_MANAGEMENT_UTILITY.:Common~1|CommonAppDataCommonAppDataFolder.:Common64CommonFiles64Folder.:CommonCommonFilesFolder.:DesktopDesktopFolder.:FAVORI~1|FavoritesFavoritesFolder.:FontsFontsFolder.:Global~1|GlobalAssemblyCacheGlobalAssemblyCache.XEROX_FONT_MANAGEMENT_UTILITYINSTALLDIR.:LocalA~1|LocalAppDataLocalAppDataFolder.:MyPict~1|MyPicturesMyPicturesFolder.:NetHoodNetHoodFolder.:PersonalPersonalFolder.:Primar~1|PrimaryVolumePathPrimaryVolumePath.:PRINTH~1|PrintHoodPrintHoodFolder.:Prog64~1|Program Files 64ProgramFiles64Folder.:PROGRA~1|program filesProgramFilesFolder.:ProgramsProgramMenuFolder.:RecentRecentFolder.:SendToSendToFolder.:STARTM~1|Start MenuStartMenuFolder.:StartUpStartupFolder.:SystemSystem16Folder.:System64System64Folder.:System32SystemFolderSourceDir.:TempTempFolder.:ShellNewTemplateFolder.:USERPR~1|UserProfileUSERPROFILE.:WindowsWindowsFolderXeroxXEROXF~1|Xerox Font Management Utilityxcwfuxcwfu1xcwfu10xcwfu11xcwfu12xcwfu13xcwfu14xcwfu15xcwfu2xcwfu3xcwfu4xcwfu5xcwfu6xcwfu7xcwfu8xcwfu9xerox_font_management_utilityxeroxcentrewarefontutilityxeroxcentrewarefontutility1xeroxcentrewarefontutility2xeroxcentrewarefontutility3xeroxcentrewarefontutility4xeroxcentrewarefontutility5xeroxcentrewarefontutility6xeroxcentrewarefontutility7xeroxcentrewarefontutility8xfmuhebrewonlinehelp{&Tahoma8}&Continue LaterxfmureadmeEnter the description for this feature here.ApplicationFilesCOMMONinstall_everytimeCOMMON_ENGLISH_ResourceDll.dllWINNT4_FMU.exeWIN9X_FontMgr.exeCOMMON_ENGLISH_FMU.hlpCOMMON_FONTFILESCOMMON_Mfc42d.dllCOMMON_Mfcd42d.dllCOMMON_Mfcn42d.dllCOMMON_Mfco42d.dllWIN9X_Msvcrt.dllWINNT4_Mfc42ud.dllWINNT4_Mfcd42ud.dllWINNT4_Mfcn42ud.dllWINNT4_Mfco42ud.dllWINNT4_Msvcrt.dllWIN9X_Ws2_32.dllWIN9X_Ws2help.dllCOMMON_Mfc42.dllWINNT4_Mfc42u.dllWIN9X_Msvcp60.dllWINNT4_Msvcp60.dllCOMMON_Converter.dllCOMMON_FMUSnmp.dllCOMMON_Xbase.dllCOMMON_Xsnmx.dllCOMMON_Xv2p.dllWIN9X_Msvcrtd.dllWINNT4_Msvcrtd.dllWIN9X_Msvcp60d.dllWINNT4_Msvcp60d.dllCOMMON_XpntStrPrfl.INICOMMON_ENGLISH_ReadMeCOMMON_RUSSIAN_ResourceDll.dllCOMMON_RUSSIAN_FMU.hlpCOMMON_KOREAN_Fmu.hlpCOMMON_KOREAN_ReadMeCOMMON_KOREAN_ResourceDll.dllF2913_Converter.dll{8DE50425-D040-11D4-AF91-0050041881F4}fmu.chm2{9AA01DD2-955A-11D3-B2D5-00C04F6BC804}readme.txt2{AD893FAB-4558-11D6-955F-0050041881F4}resourcedll.dll3{04578FCB-9558-11D3-9B77-004005368CFC}F2914_FMUSnmp.dll{8DE50426-D040-11D4-AF91-0050041881F4}F1735_fontlist.pcl{9AA01DF8-955A-11D3-B2D5-00C04F6BC804}NameTableDisplayResourceDLLTypeThe command-line arguments for the shortcut.The shortcut target. This is usually a property that is expanded to a file or a folder that the shortcut points to.YDescriptionName of the style. The primary key of this table. This name is embedded in the texts to indicate a style change.A combination of style bits.The size of the font used. This size is given in our units (1/12 of the system font height). Assuming that the system font is set to 12 point size, this is equivalent to the point size.A string indicating the name of the font used. Required. The string must be at most 31 characters long.A long integer indicating the color of the string in the RGB format (Red, Green, Blue each 0-255, RGB = R + 256*G + 256^2*B).TextActionTextActionThe predefined root key for the registry value, one of rrkEnumTemplateForeign key into the Component table referencing component that controls the deletion of the registry value.AdminExecuteSequenceA named property to be tied to this item. All the items tied to the same property become part of the same listbox.ConditionA positive integer used to determine the ordering of the items within one list..The integers do not have to be consecutive.SequenceAdminUISequenceAdvtExecuteSequenceAdvtUISequenceAppSearchPropertyThe show command for the application window.The following values may be used.Name of property, uppercase if settable by launcher or loader.AttributesName of the file to be removed.WildCardFilenameHeightWidthXName of a property whose value is assumed to resolve to the full pathname to the folder of the file to be removed.Foreign key referencing Component that controls the file to be removed.Feature_FeatureOrderingBinaryDataThe value string associated with this button. Selecting the button will set the associated property to this value.The width of the button.BindImageFile_FileThe visible title to be assigned to the radio button.PathThe icon index for the shortcut.A named property to be tied to this radio button. All the buttons tied to the same property become part of the same group.CCPSearchValueArgumentComponent_ComponentY;N;@Foreign key into the Component table denoting the component whose selection gates the the shortcut creation/deletion.Base action to determine insert location.Icon_IconIconIndexComboBoxOrderComponentIdDirectory_DirectoryKeyPath1;3;7LevelControlControl_NextDialog_DialogHelpControlConditionTable name to ignore during merge operation.ModuleIgnoreTableControl_ModuleAdvtExecuteSequenceExcludedMinVersionControlEventMinimum version of excluded module.LanguageID of module with exclusion requirement.Maximum version of excluded module.EventExcludedMaxVersionString.GUID of module with exclusion requirement.CreateFolderAn integer used to order several events tied to the same control. Can be left blank.Language of excluded module.CustomActionString.GUID of excluded module.SourceForeign key into the File table denoting the external icon file for the shortcut.ExcludedIDTargetModuleExclusionExcludedLanguageControl_CancelControl_DefaultVersion of the module.Control_FirstModule identifier (String.GUID).HCenteringDefault decimal language of module.TitleModuleInstallUISequenceVCenteringModuleInstallExecuteSequenceDefaultDirPrimary key, foreign key into File table referencing file with this hashVarious options and attributes for this hash.Directory_ParentLanguageID of the required module.RequiredLanguageThe hotkey for the shortcut. It has the virtual-key code for the key in the low-order byte, and the modifier flags in the high-order byte. RequiredVersionVersion of the required version.RequiredIDDestFolderLanguage of module requiring the dependency.ModuleLanguageString.GUID of required module.FileKeyFile;Registry;ODBCDataSourceModule requiring the dependency.ModuleDependencyErrorModuleSignatureMessageEventMappingAttributeStandard Sequence numberModuleAdvtUISequenceModuleAdminUISequenceNullableBaseActionBefore (0) or After (1)The predefined root key for the registry value, one of rrkEnum.The registry value.The key for the registry value.DisplayThe vertical coordinate of the upper left corner of the bounding rectangle of the radio button.The registry value name.Feature_ParentThe horizontal coordinate of the upper left corner of the bounding rectangle of the radio button.RegPathForeign key into the Component table referencing component that controls the installing of the registry value.FeatureComponentsThe name of the control attribute, that is set when this event is received.The height of the button.FileNameFileSizeLanguageThe help strings used with the button. The text is optional.VersionString value for property. Never null or empty.File sequence number for the last file for this media.Disk name: the visible text actually printed on the disk. This will be used to prompt the user when this disk needs to be inserted.Primary key, integer to determine sort order for table.DirPropertyA string used to set the initial text contained within a control (if appropriate).KeyA string GUID unique to this component, version, and language.The value string associated with this item. Selecting the line will set the associated property to this value.If some or all of the files stored on the media are compressed in a cabinet, the name of that cabinet.The name of the icon to be displayed with the icon. The binary information is looked up from the Binary Table.A named property to be tied to this item. All the items tied to the same property become part of the same listview.InstallExecuteSequenceInstallUISequenceInstallShieldListBoxThe help strings used with the button. The text is optional. ListViewBinary_Primary key, non-localized token.MediaCabinetDiskIdDiskPromptLastSequencePrimary key. Name of the icon file.VolumeLabelBinary stream. The binary icon data in PE (.DLL or .EXE) or icon (.ICO) format.AfterAction to insertModuleAdminExecuteSequenceThe name of the shortcut to be created.ModuleIDList of decimal language Ids, comma-separated if more than one.Size of file in bytes (long integer).File name used for installation, may be localized. This may contain a "short name|long name" pair.Primary key, non-localized token, must match identifier in cabinet. For uncompressed files, this field is ignored.Foreign key referencing Component that controls the file.Foreign key into Component table.Short text identifying a visible feature item.The install level at which record will be initially selected. An install level of 0 will disable an item and prevent its display.Name of property defining location of working directory.Optional key of a parent record in the same table. If the parent is not selected, then the record will not be installed. Null indicates a root item.Integer containing bit flags representing file attributes (with the decimal value of each bit position in parentheses)Foreign key into Feature table.Sequence with respect to the media images; order must track cabinet order.Version string for versioned files; Blank for unversioned files.Primary key used to identify a particular feature record.Numeric sort order, used to force a specific display ordering.The name of the Directory that can be configured by the UI. A non-null value will enable the browse button.OptionsUpperCaseLonger descriptive text describing a visible feature item.Foreign key into the Directory table denoting the directory where the shortcut file is created.Feature attributes0;1;2;4;5;6;8;9;10;16;17;18;20;21;22;24;25;26;32;33;34;36;37;38;48;49;50;52;53;54An identifier that specifies the type of the event that the control subscribes to.A foreign key to the Dialog table, name of the Dialog.Error formatting template, obtained from user ed. or localizers.Integer error number, obtained from header file IError(...) macros.MsiFileHashPrimary key used to identify a particular file entryHashPart1HashPart2HashPart3HashPart4Defines the control that has the focus when the dialog is created.Unique identifier for directory entry, primary key. If a property by this name is defined, it contains the full path to the directory.Reference to the entry in this table specifying the default parent directory. A record parented to itself or with a Null parent represents a root of the install tree.The default sub-path under parent's path.Width of the bounding rectangle of the dialog.A text string specifying the title to be displayed in the title bar of the dialog's window.Height of the bounding rectangle of the dialog.Vertical position of the dialog on a 0-100 scale. 0 means top end, 100 means bottom end of the screen, 50 center.Horizontal position of the dialog on a 0-100 scale. 0 means left end, 100 means right end of the screen, 50 center.Name of the dialog.Defines the default control. Hitting return is equivalent to pushing this button.Defines the cancel control. Hitting escape or clicking on the close icon on the dialog is equivalent to pushing this button.The numeric custom action type, consisting of source location, code type, entry, option flags.Excecution parameter, depends on the type of custom actionThe table reference of the source of the code.CustomSourceA 32-bit word that specifies the attribute flags to be applied to this dialog.Primary key, name of action, normally appears in sequence table unless private use.Primary key, could be foreign key into the Directory table.Installation option, one of iimEnum.A foreign key to the Control table, name of the controlAn identifier that specifies the type of the event that should take place when the user interacts with control specified by the first two entries.Foreign key into the Component table.A standard conditional statement that specifies under which conditions an event should be triggered.RadioButtonA standard conditional statement that specifies under which conditions the action should be triggered.External key to the Dialog table, name of the dialog.A foreign key to the Control table, name of the control.A foreign key to the Dialog table, name of the dialog.The name of a defined property to be linked to this control. The desired action to be taken on the specified control.Default;Disable;Enable;Hide;ShowA value to be used as a modifier when triggering a particular event.RegistryName of the control. This name must be unique within a dialog, but can repeat on different dialogs. The description for the shortcut.A positive integer used to determine the ordering of the items within one list. The integers do not have to be consecutive.The visible text to be assigned to the item. Optional. If this entry or the entire column is missing, the text is the same as the value.RootThe name of an other control on the same dialog. This link defines the tab order of the controls. The links have to form one or more cycles!RemoveFileEither the primary key into the File table, Registry table, or ODBCDataSource table. This extract path is stored when the component is installed, and is used to detect the presence of the component and to return the path to it.A conditional statement that will disable this component if the specified condition evaluates to the 'True' state. If a component is disabled, it will not be installed, regardless of the 'Action' state associated with the component.Required key of a Directory table record. This is actually a property name whose value contains the actual path, set either by the AppSearch action or with the default setting obtained from the Directory table.InstallModePrimary key used to identify a particular component record.Remote execution option, one of irsEnumRemoveRegistryA named property to be tied to this item. All the items tied to the same property become part of the same combobox.Cost1;2;3ArgumentsFilenameThe unformatted binary data.Unique key identifying the binary data.The label attributed to the volume.The property defining the location of the cabinet file.ShortcutThe type of the control.Horizontal coordinate of the upper left corner of the bounding rectangle of the control.HotkeyHeight of the bounding rectangle of the control.Vertical coordinate of the upper left corner of the bounding rectangle of the control.ShowCmdWidth of the bounding rectangle of the control.WkDirA 32-bit word that specifies the attribute flags to be applied to this control.FormattedGuidNumber that determines the sort order in which the actions are to be executed. Leave blank to suppress action.Optional expression which skips the action if evaluates to expFalse.If the expression syntax is invalid, the engine will terminate, returning iesBadActionData.Name of action to invoke, either in the engine or the handler DLL.TextStyleColorLocalized description displayed in progress dialog and log when action is executing.FaceNameName of action to be described.SizeName of tableStyleBitsSet of values that are permittedOptional localized format template used to format action data records for display during action execution.Column to which foreign key connectsMinimum value allowedWhether the column is nullableMaximum value allowedDescription of columnFor foreign key, Name of table to which data must linkUITextIdentifierName of columnText;Formatted;Template;Condition;Guid;Path;Version;Language;Identifier;Binary;UpperCase;LowerCase;Filename;Paths;AnyPath;WildCardFilename;RegPath;KeyFormatted;CustomSource;Property;Cabinet;Shortcut;URLNString categoryRemoveSetUpgradeCodeCategoryKeyColumnKeyTableMinValue_ValidationMaxValueColumnMsiPatchOldAssemblyNameAssembly_MsiPatchOldAssemblyFileThe localized version of the string.A unique key that identifies the particular string.DisplayResourceIdDescriptionResourceDLLDescriptionResourceIdThis field contains a Formatted string value for the full path to the language neutral file that contains the MUI manifest.The description name index for the shortcut.The display name index for the shortcut.OSISComponentExtendedFilterPropertybitwise addition of OSsProperty to set if you want to filter a componentAction_ISCustomActionReferenceFileTypeContents of the file speciifed in ISCAReferenceFilePath. This column is only used by MSI.Foreign key into theICustomAction table.file type of the file specified ISCAReferenceFilePath. This column is only used by MSI.InstallingInstalledUninstallingInstallTextCmdLineISSelfRegForeign key to the file tableCostFinalizeCostInitializeFileCostInstallAdminPackageI ,s pg} >lr '{ M> rGr 5 z   u)     "  , #0#1 T Q    #  H-"   ,   ?_anK<067 R>nfns  = !   # O'?%cs9!.8vJA9>k :_QR6@C 4    B).[/qsQ|^:. NS;$7%d f586=8 Dd!{  ;' s '#7$X0V/O oB T   j$6 ^    $3{,( 1Y(X       !! )                 4 ;  $ +"                      & ,(&& &&&&&&&&#&&&&&&&&&& &{23BB349B-7B23-48D6-9FC7-C778C91BCEE0}{5B3B0781-F608-4C56-8E71-F8B23E965C87}{95B5B60C-1264-42FF-94D2-46CEB99DBF08}F2126_Mfc42.dllVersion9X>=400 OR VersionNT<500{9AA01E25-955A-11D3-B2D5-00C04F6BC804}F1770_Mfc42d.dllVersion9X >= 400 OR VersionNT < 500{9AA01DF9-955A-11D3-B2D5-00C04F6BC804}F1771_Mfcd42d.dll{9AA01DFA-955A-11D3-B2D5-00C04F6BC804}F1772_Mfcn42d.dll{9AA01DFB-955A-11D3-B2D5-00C04F6BC804}F1773_Mfco42d.dll{9AA01DFC-955A-11D3-B2D5-00C04F6BC804}{804F038B-5ABB-461D-9B9C-6A6B12084B76}{C75E290B-1D8F-45F9-B520-C3FCC3E88FAF}F2915_xbase.dll{8DE50427-D040-11D4-AF91-0050041881F4}F3746_XpntStrPrfl.ini{08B5ED3A-AA2F-4B03-9A0D-3F095549C6E4}F2916_xsnmx.dll{8DE50428-D040-11D4-AF91-0050041881F4}F2917_xv2p.dll{8DE50429-D040-11D4-AF91-0050041881F4}F2912_FMU.exeVersion9X >=400{9AA01DD1-955A-11D3-B2D5-00C04F6BC804}F2337_Msvcp60.dllVersion9X >= 400{47C92EB7-DE34-11D3-B555-0050041881F4}F3040_Msvcp60d.dll{0CF888D7-F234-11D4-AF98-0050041881F4}F1774_Msvcrt.dll{9AA01DFD-955A-11D3-B2D5-00C04F6BC804}F3038_Msvcrtd.dll{0CF888D5-F234-11D4-AF98-0050041881F4}F2067_Ws2_32.dllVersion9X<401{9AA01E19-955A-11D3-B2D5-00C04F6BC804}F2068_Ws2help.dll{9AA01E1A-955A-11D3-B2D5-00C04F6BC804}F2911_FMU.exeVersionNT>=400{9AA01DCE-955A-11D3-B2D5-00C04F6BC804}F2156_Mfc42u.dllVersionNT<500{9AA01E26-955A-11D3-B2D5-00C04F6BC804}F1920_Mfc42ud.dll{9AA01E0A-955A-11D3-B2D5-00C04F6BC804}F1921_Mfcd42ud.dll{9AA01E0B-955A-11D3-B2D5-00C04F6BC804}F1922_Mfcn42ud.dll{9AA01E0C-955A-11D3-B2D5-00C04F6BC804}F1923_Mfco42ud.dll{9AA01E0D-955A-11D3-B2D5-00C04F6BC804}F2338_Msvcp60.dll{47C92EB8-DE34-11D3-B555-0050041881F4}F3041_Msvcp60d.dll{0CF888D8-F234-11D4-AF98-0050041881F4}F1924_Msvcrt.dll{9AA01E0E-955A-11D3-B2D5-00C04F6BC804}F3039_Msvcrtd.dll{0CF888D6-F234-11D4-AF98-0050041881F4}{C8A2243B-1CF1-435D-8453-3D1E9C67D10B}10332.3.3.12RESOUR~1.DLL|ResourceDll.dllFMU.exeFmu.chmFONTLI~1.PS|fontList_a4.psfontlist_a4.psfontlist.pclMSVCRT~1.DLL|Msvcrt.dllfontlist_letter.psFONTLI~1.PCL|fontlist1.pclF3071_fontlist1.pclPH_FON~1.PS|Ph_fontlist.psF3073_Ph_fontlist.ps6.0.8168.0Mfc42d.dllMfcd42d.dllMfcn42d.dllMfco42d.dll6.0.8397.0Msvcrt.dll6.0.8447.0Mfc42ud.dllMfcd42ud.dllMfcn42ud.dllMfco42ud.dll4.10.0.2222Ws2_32.dll4.10.0.1998Ws2help.dllMfc42.dllMfc42u.dllMsvcp60.dllCONVER~1.DLL|Converter.dllFMUSnmp.dll2001.315.646.1xbase.dllxsnmx.dllxv2p.dll5.0.0.7022Msvcrtd.dllMsvcp60d.dllXPNTST~1.INI|XpntStrPrfl.iniREADME.TXTSearching for installed applicationsRemoving IIS Virtual Roots...caCreateVRootsAdvertising applicationcaRemoveVRootsBinding executablesProperty: [1], Signature: [2]Searching for qualifying productsFile: [1]Computing space requirementsGenerating script operations for action:AdvertiseCreating foldersFree space: [1]Deleting servicesFolder: [1]Publishing qualified componentsShortcut: [1]Creating duplicate filesService: [1]Installing ODBC componentsCopying files to the networkRolling back action:GenerateScriptCopying new filesFile: [1], Directory: [9], Size: [6]Validating installFile: [1], Directory: [9], Size: [6]Installing new servicesEvaluating launch conditionsService: [2]Creating shortcutsMoving filesPatching filesUpdating component registrationFile: [1], Directory: [2], Size: [3]Registering fontsPublishing product featuresComponent ID: [1], Qualifier: [2]Publishing product informationFeature: [1]Registering class serversRegistering extension serversClass ID: [1]Registering MIME infoExtension: [1]Registering productFont: [1]Unregistering program identifiersMIME Content Type: [1], Extension: [2]Registering userRegistering type librariesProgID: [1]Allocating registry spaceLibID: [1]Removing d  "#$%&')*+,./0123456789:;<=[@ABCDEFGHLNOPQRSUWYZ\]^`abcefghijklmnopqrstuvwxyz{|}~IJLNPQSUWY[]_abdfhjlnprtvxz|~IIIrPIIIIIIIPaIIIIIIIIIIIIIIIIIIIIttttttttttttttttttttttttttttHKMORTVXZ\^`cegikmoqsuwy{} VVddbb-1] F >$M5h"q #   "bbbbbbbbbbbbbbbbb    !`< 0+  96 "  !*-/1E(O&F+B3456HNIJ DM8L?A'C:;<= , ) .0 p)8704050550 ?0B?=06 M5 `0805`6`66@ 6 M5LdPeP %92222GGG227K>@999992272$$$$$$$$$$$$$$$$$$$$$$$$$ #!"  q sQ | ^:.   *-/169>!TV3>Ec5A|L1122+rbstӥ!s7Tm0X2̪ljlj=iiMaF]Zh%)1%j nt%>!%>!HJQ$*/` ɣ su D-h G G8JEf ')  7X_ !"#$%&()*+,-./0123456789:RT[k PUWYYYhlnsbz|~\`dfpqtuwyWQSZiVXmoc{}]aeoroxacee{}X %`Vr  !"$&')*,.024689;=>?@BDFHIKMOQSUWYu     #% (+-/57:<:%:A3CE:JGLNPRTX$     JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@:"w!1AQaq"2rB31!AQ ?-5bt2R+S%^k][ԶLL{%;e+sg+ssls[9[oyGV̬f1 fڶ3aHWXn - >2xrdg>P+6Xԣ[%xZaJF?x'Pw[Yc(zM}ͷkm_펟%N AjWgce^eR~San3=39<[w>Y˖֟!um *4;wHW1njv][h 6Hɬ5iI*ƀ;@%2R4j{=w-c>>n?ߓKQcviUmWV]kžb;cٟ|DDr> Yק&P&P&P&P&P&P&P&P&P&P&P&P&P&P(( Oh+'0$Lhpx     DavidHackerInstallation Database 1.00Xerox Font Management UtilityInstaller; MSI; DatabaseXerox Font Management UtilityXerox Corporation)InstallShield 12 - Premier Edition 12.0'{F8DC3B4D-A8B7-4C07-ADFA-ED017B96BC8D}@@@ Intel;1033 ?@    '̐ x܅ș򃔑8\$|9ڂЂƂtЇr؎|@ԗpH䌬`(XL lĉTP쓈D4 ҙ7_ (;BDG  E  'ACF 2(X%+,-8PTZmz56?BQ5Vh{!.567<?BFQb%%%+++,,,---88PPPPPPPPTTZZZZZZZZmmmmmmzz  }&P(( uplicated filesUpdating environment stringsFile: [1], Directory: [9]Removing filesName: [1], Value: [2], Action [3]Removing foldersRemoving INI file entriesRemoving ODBC componentsFile: [1], Section: [2], Key: [3], Value: [4]Removing system registry valuesRemoving shortcutsKey: [1], Name: [2]Registering modulesRemoving backup filesRollbackRemoving moved filesRollbackCleanupUnregistering modulesFile: [1], Folder: [2]Initializing ODBC directoriesStarting servicesStopping servicesUnpublishing Qualified ComponentsUnpublishing product informationCreating IIS virtual directory %sUnmoveFilesUnpublishing product featuresUnregister class serversSearching for related applicationsUnpublishProductUnregistering extension serversUnregistering fontsUnregistering MIME infoUnregistering type librariesWriting INI file valuesWriting system registry valuesRegistering COM+ Applications and ComponentsKey: [1], Name: [2], Value: [3]Unregistering COM+ Applications and ComponentsAppId: [1]{{, AppType: [2], Users: [3], RSN: [4]}}CremzZmZK I PI I K h k i#i'i'i'i'iiiiTii'iNiiiTLiLiiiLiiiiiiiiL'iiii'i'LiiLiiiLii'ii'ii#iiiiii'ii'iiii'i'iiLiii8Ri'iiiLLLiiiiCiLiiLiii5LiiLiiiiiiiiiiiiiiiiinmXZ_TRPTRPTRPTRP<xvz.,~{oqmki*Y\,6=(F;B9@_v_v_v_v_v|tTRPTRP&,(3,(03-#1_vkkkk[^ WV(LN@M$!Ldr]L;y \fc^oagbdj   G J U V X Z \ ^ L N O P R |P P b d f g j dd    # ') ') ') ')8bP >UZl >)m>'U8bJ HD>8HD> 'g'Rl Ol ') ')8b8bCTXVR[Y8bJ HD)bll %)l5l :y|?C%%%+++,,,---88PPPPPPPPTTZZZZZZZZmmmmmmzz555666==????BBBBBQQQQQQaaaaa5555555555555555VVVVVhh{{{{{{{{{{I I K K K K K K M M M M M T T a a e e e e # ') ') ') ')8b >PU)>Zl '>mU8b 8>DHJ>DH ' ')]'Rgl f ')] ')]ff ')] ')]Ol ') ')8b8b8bCRTVX[ ')]Y 8DHJbbl)l %l) ly|5:?CVWY[]) qsuwy|}bYl  H I Q W Y [ ] _ M Q S OQ ` c 8bi l n n n n n nn nn n nnn nnnn nn n nn nnnnn nn nnnn n nnn nn nnnnnnn nnnnnnnn nnnnn n n nnnn nnnnnnnn n nnn n n nnn nnn n n n nnnnnnn nnnnnn nnnnnn nn nnnnn n nn n n nn nn n nn nn n n n n nnn n nn nnnn nndd PmZmPmTaZmmmVY[W])}y|wusq l HHHHHH&&@HHHHHH&HHHH@@HHH2222H222H22H22HHH@H222&HHHH@@H@@H@ HHH@@2HHHHHHHHHHHHH H  HHHH2_anKating IIS Virtual Roots...AppId: [1]{{, AppType: [2]}}Migrating feature states from related applicationsFound application: [1]FindRelatedProductsRemoving applicationsApplication: [1]MigrateFeatureStatesInstalling system catalogApplication: [1], Command line: [2]RemoveExistingProductsExtracted information for IIS virtual directories...File: [1], Dependencies: [2]InstallSFPCatalogFile[1]Creating application Pools...PROGMSG_IIS_EXTRACTzDONECreating IIS virtual directories...PROGMSG_IIS_CREATEVROOTExtracting i&&&& && & &&&&&&&&&&                          $! (    $&  &!   !&  !/! ! ",.22#4#5!#6"%&"%!&&(nformation for IIS virtual directories...PROGMSG_IIS_CREATEVROOTSRemoving web site at port %dPROGMSG_IIS_EXTRACTPROGMSG_IIS_EXTRACTDONERemoving IIS virtual directory %sPROGMSG_IIS_REMOVESITERemoving IIS virtual directories...PROGMSG_IIS_REMOVEVROOTRolling back virtual directory and web site changes...PROGMSG_IIS_REMOVEVROOTSPROGMSG_IIS_ROLLBACKVROOTSPROGMSG_IIS_EXTRACTDONEzCreating application pool %sPROGMSG_IIS_CREATEAPPPOOLSCreating web service extensionPROGMSG_IIS_CREATEAPPPOOLCreating web service extensions...PROGMSG_IIS_CREATEWEBSERVICEEXTENSIONRemoving application poolPROGMSG_IIS_CREATEWEBSERVICEEXTENSIONSRemoving application pools...PROGMSG_IIS_REMOVEAPPPOOLRemoving web service extensionPROGMSG_IIS_REMOVEAPPPOOLSRemoving web service extensions...PROGMSG_IIS_REMOVEWEBSERVICEEXTENSIONRolling back application pools...PROGMSG_IIS_REMOVEWEBSERVICEEXTENSIONSRolling back web service extensions...PROGMSG_IIS_ROLLBACKAPPPOOLShttp://www.xerox.comPROGMSG_IIS_ROLLBACKWEBSERVICEEXTENSIONS{4D649617-55FE-4295-B260-9D8055B7C4DA}NewFolder-NOTUSEDNewFolderTahoma8DefaultUIFontNoAgreeToLicenseinstallProgressType0Typical_IsSetupTypeMinChange_IsMaintenance1-800-ASKXEROXARPHELPLINKARPHELPTELEPHONEInstallShield for Windows InstallerDialogCaption1234-5678DiskSerial1Display_IsBitmapDlgSetupErrorErrorDialogARInstallChoice100INSTALLLEVELManufacturer12345<###-%%%%%%%>@@@@@PIDTemplateYesRebootYesNoRegistratonoReinstallFileVersionrReinstallRepairSetupTypeAllUsersApplicationUsersProgressType1installedProgressType2installsProgressType3omusReinstallModeTextARPURLINFOABOUTCosting COM+ application: [1]ARPURLUPDATEINFO{91F12316-F23D-11D4-AF98-0050041881F4}ProductCodeCentreWare Font UtilityDP_APP_CHECKCOMPANY_APP_CHECK0ISVROOT_PORT_NOXerox Font Management UtilityProductNameSHOWLAUNCHPROGRAMProductVersionFileInUseProcess30DWUSINTERVALInstalling COM+ application: [1]IS_COMPLUS_PROGRESSTEXT_COSTUninstalling COM+ application: [1]IS_COMPLUS_PROGRESSTEXT_INSTALLCosting XML files...IS_COMPLUS_PROGRESSTEXT_UNINSTALLIS_SQLSERVER_AUTHENTICATIONsaIS_SQLSERVER_USERNAMECreating XML file %s...IS_PROGMSG_XML_COSTINGPerforming XML file changes...IS_PROGMSG_XML_CREATE_FILERemoving XML file %s...IS_PROGMSG_XML_FILESRolling back XML file changes...IS_PROGMSG_XML_REMOVE_FILEUpdating XML file %s...IS_PROGMSG_XML_ROLLBACK_FILESApplication FilesIS_PROGMSG_XML_UPDATE_FILECloseRestartRestartManagerOptionNew_Binary1NewBinary22NewBinary21NewBinary20NewBinary19NewBinary1NewBinary2NewBinary3NewBinary4NewBinary5NewBinary6NewBinary7NewBinary8NewBinary9NewBinary10NewBinary11NewBinary12NewBinary13NewBinary14NewBinary15NewBinary16NewBinary17NewBinary18ISSELFREG.DLLNOT UpdateStartedDisableCancelUpdateStartedEnableDefaultBackFinishHideFinishText1ShowFinishText2RestContText1RestContText2ProgressType2="installed"TextLine2ProgressType2="uninstalled"TextLine3RESUMEPreselectedTextNOT RESUMEResumeTextDlgDescProgressType1="Installing"DlgTitleProgressType3="installs"DlgTextProgressType1="Uninstalling"DlgTitle2ProgressType3="uninstalls"DlgText2DlgDesc2DetailsCustomSetupChangeFolderInstallLabelProgressType0="Modify"ReadyToInstallProgressType0="Repair"ProgressType0="install"DlgTitle3AgreeToLicense <> "Yes"NextLicenseAgreementAgreeToLicense = "Yes"ProductState > 0RadioGroupCustomerInformationNOT AdminUserVersion9XDlgRadioGroupTextIS_SQLSERVER_AUTHENTICATION=0EdtPswdSQLLoginIS_SQLSERVER_AUTHENTICATION=1lblPswdEdtLoginlblLoginIDErrorNoEndDialogErrorYesErrorCancelCErrorOkOErrorAbortAErrorIgnoreIErrorRetryRCancelSetupSpawnDialogNewDialog_IsSetupTypeMin <> "Typical"_IsSetupTypeMin = "Typical"Return[Suspend]{}ExitOKLAUNCHPROGRAMIS_LAUNCH_MY_PROGRAM_PLEASEDoActionOutOfDiskSpace <> 1OutOfDiskSpace = 1OutOfSpaceMaintenanceTypeSplashBitmapAdminNetworkLocationAdminChangeFolderResetSetTargetPathDirectoryListNewDirectoryListUpUpInstallNowBrowseResumeInstallChangeFolder[_BrowseProperty]CustomSetupTips(OutOfDiskSpace <> 1)DiskSpaceRequirementsSelectionBrowse_IsMaintenance = "Change"_IsMaintenance = "Reinstall"_IsMaintenance = "Remove"ReadyToRemoveALLReinstall[ReinstallModeText]ReinstallModeRepairing[ProgressType1&     #   f             &      "!                        h  >            &   L   $  #         '  (         -)*       ]Modifyingmodified[ProgressType2]repairs[ProgressType3]modifiesModify[ProgressType0]RepairNOT Installed AND _IsSetupTypeMin = "Typical"Installed OR _IsSetupTypeMin <> "Typical"Installed AND _IsMaintenance = "Reinstall"FilesInUseRetryIgnoreApplicationUsers = "AllUsers"[ALLUSERS]RemoveNowuninstalleduninstallsDestinationFolderPostUninstallDialogok_cmdOldVersionDialoglaunchDPUninstcancel_cmdSQLBrowse[IS_SQLSERVER_LIST][IS_SQLSERVER_SERVER]IS_SQLSERVER_STATUS=0ISSQLServerValidateBtnSQLBrowseISSQLServerListMsiRMFilesInUseRestartManagerOption="CloseRestart"RMShutdownAndRestart[%ALLUSERSPROFILE][%SystemRoot]\Profiles\All Users[%USERPROFILE]launchDPUninstallermsgbox "Previous Version: " + Session.property("DP_APP_INSTALLED") showLanguagetestDpAppInstalledpreviousDPVersionInstalledError [1].Warning [1].Info [1].Internal Error [1]. [2]{, [3]}{, [4]}{{Disk full: }}Action [Time]: [1]. [2][ProductName]{[2]}{, [3]}{, [4]}Message type: [1], Argument: [2]=== Logging started: [Date] [Time] ====== Logging stopped: [Date] [Time] ===Action start [Time]: [1].Action ended [Time]: [1]. Return value [2].Time remaining: {[1] minutes }{[2] seconds}Out of memory. Shut down other applications before retrying.Installer is no longer responding.Installer terminated prematurely.Please wait while Windows configures [ProductName]Gathering required information...Removing older versions of this application...Preparing to remove older versions of this application...{[ProductName] }Setup completed successfully.{[ProductName] }Setup failed.Error reading from file: [2]. {{ System error [3].}} Verify that the file exists and that you can access it.Cannot create the file [3]. A directory with this name already exists. Cancel the installation and try installing to a different location.Please insert the disk: [2]The installer has insufficient privileges to access this directory: [2]. The installation cannot continue. Log on as an administrator or contact your system administrator.Error writing to file [2]. Verify that you have access to that directory.Error reading from file [2]. Verify that the file exists and that you can access it.Another application has exclusive access to the file [2]. Please shut down all other applications, then click Retry.There is not enough disk space to install thi file [2]. Free some disk space and click Retry, or click Cancel to exit.Source file not found: [2]. Verify that the file exists and that you can access it.Error reading from file: [3]. {{ System error [2].}} Verify that the file exists and that you can access it.Error writing to file: [3]. {{ System error [2].}} Verify that you have access to that directory.Source file not found{{(cabinet)}}: [2]. Verify that the file exists and that you can access it.Cannot create the directory [2]. A file with this name already exists. Please rename or remove the file and click Retry, or click Cancel to exit.The volume [2] is currently unavailable. Please select another.The specified path [2] is unavailable.Unable to write to the specified folder [2].A network error occurred while attempting to read from the file [2]An error occurred while attempting to create the directory [2]A network error occurred while attempting to create the directory [2]A network error occurred while attempting to open the source file cabinet [2].The specified path is too long [2].The Installer has insufficient privileges to modify the file [2].A portion of the path [2] exceeds the length allowed by the system.The path [2] contains words that are not valid in folders.The path [2] contains an invalid character.[2] is not a valid short file name.Error getting file security: [3] GetLastError: [2]Invalid Drive: [2]Error applying patch to file [2]. It has probably been updated by other means, and can no longer be modified by this patch. For more information contact your patch vendor. {{System Error: [3]}}A file that is required cannot be installed because the cabinet file [2] is not digitally signed. This may indicate that the cabinet file is corrupt.A file that is required cannot be installed because the cabinet file [2] has an invalid digital signature. This may indicate that the cabinet file is corrupt.{ Error [3] was returned by WinVerifyTrust.}Failed to correctly copy [2] file: CRC error.Failed to correctly patch [2] file: CRC error.The file '[2]' cannot be installed because the file cannot be found in cabinet file '[3]'. This could indicate a network error, an error reading from the CD-ROM, or a problem with this package.The cabinet file '[2]' required for this installation is corrupt and cannot be used. This could indicate a network error, an error reading from the CD-ROM, or a problem with this package.There was an error creating a temporary file that is needed to complete this installation. Folder: [3]. System error code: [2]Could not create key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not open key: [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not delete value [2] from key [3]. {{ System error [4].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not delete key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not read value [2] from key [3]. {{ System error [4].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not write value [2] to key [3]. {{ System error [4].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not get value names for key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not get sub key names for key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not read security information for key [2]. {{ System error [3].}} Verify that you have sufficient access to that key, or contact your support personnel.Could not increase the available registry space. [2] KB of free registry space is required for the installation of this application.Another installation is in progress. You must complete that installation before continuing this one.Error accessing secured data. Please make sure the Windows Installer is configured properly and try the installation again.User [2] has previously initiated an installation for product [3]. That user will need to run that installation again before using that product. Your current installation will now continue.User [2] has previously initiated an installation for product [3]. That user will need to run that installation again before using that product.Out of disk space -- Volume: '[2]'; required space: [3] KB; available space: [4] KB. Free some disk space and retry.Are you sure you want to cancel?The file [2][3] is being held in use{ by the following process: Name: [4], ID: [5], Window Title: [6]}. Close that application and retry.The product [2] is already installed, preventing the installation of this product. The two products are incompatible.Out of disk space -- Volume: [2]; required space: [3] KB; available space: [4] KB. If rollback is disabled, enough space is available. Click Cancel to quit, Retry to check available disk space again, or Ignore to continue without rollback.Could not access network location [2].The following applications should be closed before continuing the installation:Could not find any previously installed compliant products on the machine for installing this product.An error occurred while applying security settings. [2] is not a valid user or group. This could be a problem with the package, or a problem connecting to a domain controller on the network. Check your network connection and click Retry, or Cancel to end the install. Unable to locate the user's SID, system error [3]Admin user failed to apply patch for a per-user managed or a per-machine application which is in advertise state.The key [2] is not valid. Verify that you entered the correct key.The installer must restart your system before configuration of [2] can continue. Click Yes to restart now or No if you plan to restart later.You must restart your system for the configuration changes made to [2] to take effect. Click Yes to restart now or No if you plan to restart later.An installation for [2] is currently suspended. You must undo the changes made by that installation to continue. Do you want to undo those changes?A previous installation for this product is in progress. You must undo the changes made by that installation to continue. Do you want to undo those changes?No valid source could be found for product [2]. The Windows Installer cannot continue.Installation operation completed successfully.Installation operation failed.Product: [2] -- [3]You may either restore your computer to its previous state or continue the installation later. Would you like to restore?An error occurred while writing installation information to disk. Check to make sure enough disk space is available, and click Retry, or Cancel to end the installation.One or more of the files required to restore your computer to its previous state could not be found. Restoration will not be possible.[2] cannot install one of its required products. Contact your technical support group. {{System Error: [3].}}The older version of [2] cannot be removed. Contact your technical support group. {{System Error [3].}}Installed [2].Configured [2].Removed [2].File [2] was rejected by digital signature policy.Windows Installer service could not be accessed. Contact your support personnel to verify that it is properly registered and enabled.There is a problem with this Windows Installer package. A script required for this install to complete could not be run. Contact your support personnel or package vendor. Custom action [2] script error [3], [4]: [5] Line [6], Column [7], [8]There is a problem with this Windows Installer package. A program required for this install to complete could not be run. Contact your support personnel or package vendor. Action: [2], location: [3], command: [4]There is a problem with this Windows Installer package. A program run as part of the setup did not finish as expected. Contact your support personnel or package vendor. Action [2], location: [3], command: [4]There is a problem with this Windows Installer package. A DLL required for this install to complete could not be run. Contact your support personnel or package vendor. Action [2], entry: [3], library: [4]Removal completed successfully.Removal failed.Advertisement completed successfully.Advertisement failed.Configuration completed successfully.Configuration failed.You must be an Administrator to remove this application. To remove this application, you can log on as an administrator, or contact your technical support group for assistance.The source installation package for the product [2] is out of sync with the client package. Try the installation again using a valid copy of the installation package '[3]'.In order to complete the installation of [2], you must restart the computer. Other users are currently logged on to this computer, and restarting may cause them to lose their work. Do you want to restart now?The path [2] is not valid. Please specify a valid path.There is no disk in drive [2]. Please insert one and click Retry, or click Cancel to go back to the previously selected volume.There is no disk in drive [2]. Please insert one and click Retry, or click Cancel to return to the browse dialog and select a different volume.The folder [2] does not exist. Please enter a path to an existing folder.You have insufficient privileges to read this folder.A valid destination folder for the installation could not be determined.Error attempting to read from the source installation database: [2].Scheduling reboot operation: Renaming file [2] to [3]. Must reboot to complete operation.Scheduling reboot operation: Deleting file [2]. Must reboot to complete operation.Module [2] failed to register. HRESULT [3]. Contact your support personnel.Module [2] failed to unregister. HRESULT [3]. Contact your support personnel.Failed to cache package [2]. Error: [3]. Contact your support personnel.Could not register font [2]. Verify that you have sufficient permissions to install fonts, and that the system supports this font.Could not unregister font [2]. Verify that you have sufficient permissions to remove fonts.Could not create shortcut [2]. Verify that the destination folder exists and that you can access it.Could not remove shortcut [2]. Verify that the shortcut file exists and that you can access it.Could not register type library for file [2]. Contact your support personnel.Could not unregister type library for file [2]. Contact your support personnel.Could not update the INI file [2][3]. Verify that the file exists and that you can access it.Could not schedule file [2] to replace file [3] on reboot. Verify that you have write permissions to file [3].Error removing ODBC driver manager, ODBC error [2]: [3]. Contact your support personnel.Error installing ODBC driver manager, ODBC error [2]: [3]. Contact your support personnel.Error removing ODBC driver [4], ODBC error [2]: [3]. Verify that you have sufficient privileges to remove ODBC drivers.Error installing ODBC driver [4], ODBC error [2]: [3]. Verify that the file [4] exists and that you can access it.Error configuring ODBC data source [4], ODBC error [2]: [3]. Verify that the file [4] exists and that you can access it.Service [2] ([3]) failed to start. Verify that you have sufficient privileges to s$$tart system services.Service [2] ([3]) could not be stopped. Verify that you have sufficient privileges to stop system services.Service [2] ([3]) could not be deleted. Verify that you have sufficient privileges to remove system services.Service [2] ([3]) could not be installed. Verify that you have sufficient privileges to install system services.Could not update environment variable [2]. Verify that you have sufficient privileges to modify environment variables.You do not have sufficient privileges to complete this installation for all users of the machine. Log on as an administrator and then retry this installation.Could not set file security for file [3]. Error: [2]. Verify that you have sufficient privileges to modify the security permissions for this file.Component Services (COM+ 1.0) are not installed on this computer. This installation requires Component Services in order to complete successfully. Component Services are available on Windows 2000.Error registering COM+ application. Contact your support personnel for more information.Error unregistering COM+ application. Contact your support personnel for more information.The description for service '[2]' ([3]) could not be changed.The Windows Installer service cannot update the system file [2] because the file is protected by Windows. You may need to update your operating system for this program to work correctly. {{Package version: [3], OS Protected version: [4]}}The Windows Installer service cannot update the protected Windows file [2]. {{Package version: [3], OS Protected version: [4], SFP Error: [5]}}The Windows Installer service cannot update one or more protected Windows files. SFP Error: [2]. List of protected files: [3]User installations are disabled via policy on the machine.An error occurred during the installation of assembly component [2]. HRESULT: [3]. {{assembly interface: [4], function: [5], assembly name: [6]}}An error occurred during the installation of assembly '[6]'. The assembly is not strongly named or is not signed with the minimal key length. HRESULT: [3]. {{assembly interface: [4], function: [5], component: [2]}}An error occurred during the installation of assembly '[6]'. The signature or catalog could not be verified or is not valid. HRESULT: [3]. {{assembly interface: [4], function: [5], component: [2]}}An error occurred during the installation of assembly '[6]'. One or more modules of the assembly could not be found. HRESULT: [3]. {{assembly interface: [4], function: [5], component: [2]}}Shortcuts not supported by the operating system.Invalid .ini action: [2]Could not resolve path for shell folder [2].Writing .ini file: [3]: System error: [2].Shortcut Creation [3] Failed. System error: [2].Shortcut Deletion [3] Failed. System error: [2].Error [3] registering type library [2].Error [3] unregistering type library [2].Section missing for .ini action.Key missing for .ini action.Detection of running applications failed, could not get performance data. Registered operation returned : [2].Detection of running applications failed, could not get performance index. Registered operation returned : [2].Detection of running applications failed.Database: [2]. Database object creation failed, mode = [3].Database: [2]. Initialization failed, out of memory.Database: [2]. Data access failed, out of memory.Database: [2]. Cannot open database file. System error [3].Database: [2]. Table already exists: [3].Database: [2]. Table does not exist: [3].Database: [2]. Table could not be dropped: [3].Database: [2]. Intent violation.Database: [2]. Insufficient parameters for Execute.Database: [2]. Cursor in invalid state.Database: [2]. Invalid update data type in column [3].Database: [2]. Could not create database table [3].Database: [2]. Database not in writable state.Database: [2]. Error saving database tables.Database: [2]. Error writing export file: [3].Database: [2]. Cannot open import file: [3].Database: [2]. Import file format error: [3], Line [4].Database: [2]. Wrong state to CreateOutputDatabase [3].Database: [2]. Table name not supplied.Database: [2]. Invalid Installer database format.Database: [2]. Invalid row/field data.Database: [2]. Code page conflict in import file: [3].Database: [2]. Transform or merge code page [3] differs from database code page [4].Database: [2]. Databases are the same. No transform generated.Database: [2]. GenerateTransform: Database corrupt. Table: [3].Database: [2]. Transform: Cannot transform a temporary table. Table: [3].Database: [2]. Transform failed.Database: [2]. Invalid identifier '[3]' in SQL query: [4].Database: [2]. Unknown table '[3]' in SQL query: [4].Database: [2]. Could not load table '[3]' in SQL query: [4].Database: [2]. Repeated table '[3]' in SQL query: [4].Database: [2]. Missing ')' in SQL query: [3].Database: [2]. Unexpected token '[3]' in SQL query: [4].Database: [2]. No columns in SELECT clause in SQL query: [3].Database: [2]. No columns in ORDER BY clause in SQL query: [3].Database: [2]. Column '[3]' not present or ambiguous in SQL query: [4].Database: [2]. Invalid operator '[3]' in SQL query: [4].Database: [2]. Invalid or missing query string: [3].Database: [2]. Missing FROM clause in SQL query: [3].Database: [2]. Insufficient values in INSERT SQL statement.Database: [2]. Missing update columns in UPDATE SQL statement.Database: [2]. Missing insert columns in INSERT SQL statement.Database: [2]. Column '[3]' repeated.Database: [2]. No primary columns defined for table creation.Database: [2]. Invalid type specifier '[3]' in SQL query [4].IStorage::Stat failed with error [3].Database: [2]. Invalid Install@HA0C??(E8BA(HJ<@HAEFAE(?(E8BA(HK`@HRDEC;;B&F7BB4FhD&B:M@HRDEC??(E8BA(H3Txer transform format.Database: [2] Transform stream read/write failure.Database: [2] GenerateTransform/Merge: Column type in base table does not match reference table. Table: [3] Col #: [4].Database: [2] GenerateTransform: More columns in base table than in reference table. Table: [3].Database: [2] Transform: Cannot add existing row. Table: [3].Database: [2] Transform: Cannot delete row that does not exist. Table: [3].Database: [2] Transform: Cannot add existing table. Table: [3].Database: [2] Transform: Cannot delete table that does not exist. Table: [3].Database: [2] Transform: Cannot update row that does not exist. Table: [3].Database: [2] Transform: Column with this name already exists. Table: [3] Col: [4].Database: [2] GenerateTransform/Merge: Number of primary keys in base table does not match reference table. Table: [3].Database: [2]. Intent to modify read only table: [3].Database: [2]. Type mismatch in parameter: [3].Database: [2] Table(s) Update failedStorage CopyTo failed. System error: [3].Could not # F    %  ''++<"!2!.9-mJUuwTmba@&,C>EN#AC:+#2-.~d{u v&Of=qCW.yni 2%%8J5HDYRMOH[d_NP^oXZwrxhlnqwY[=}:0,*00') no);41;))/ 3'63.,.,77'1&6T>?I :5<6-8=?G845;>>%==%22w`=K?MKSw5/$)/.- remove stream [2]. System error: [3].Stream does not exist: [2]. System error: [3].Could not open stream [2]. System error: [3].Could not commit storage. System error: [3].Could not rollback storage. System error: [3].Could not delete storage [2]. System error: [3].Database: [2]. Merge: There were merge conflicts reported in [3] tables.Database: [2]. Merge: The column count differed in the '[3]' table of the two databases.Database: [2]. GenerateTransform/Merge: Column name in base table does not match reference table. Table: [3] Col #: [4].SummaryInformation write for transform failed.Database: [2]. MergeDatabase will not write any changes because the database is open read-only.Database: [2]. MergeDatabase: A reference to the base database was passed as the reference database.Database: [2]. MergeDatabase: Unable to write errors to Error table. Could be due to a non-nullable column in a predefined Error table.Database: [2]. Specified Modify [3] operation invalid for table joins.Database: [2]. Code page [3] not supported by the system.Database: [2]. Failed to save table [3].Database: [2]. Exceeded number of expressions limit of 32 in WHERE clause of SQL query: [3].Database: [2] Transform: Too many columns in base table [3].Database: [2]. Could not create column [3] for table [4].Could not rename stream [2]. System error: [3].Stream name invalid [2].Patch notify: [2] bytes patched to far.Error getting volume info. GetLastError: [2].Error getting disk free space. GetLastError: [2]. Volume: [3].Error waiting for patch thread. GetLastError: [2].Could not create thread for patch application. GetLastError: [2].Source file key name is null.Destination file name is null.Attempting to patch file [2] when patch already in progress.Attempting to continue patch when no patch is in progress.Missing path separator: [2].File does not exist: [2].Error setting file attribute: [3] GetLastError: [2].File not writable: [2].Error creating file: [2].User canceled.Invalid file attribute.Could not open file: [3] GetLastError: [2].Could not get file time for file: [3] GetLastError: [2].Error in FileToDosDateTime.Could not remove directory: [3] GetLastError: [2].Error getting file version info for file: [2].Error deleting file: [3]. GetLastError: [2].Error getting file attributes: [3]. GetLastError: [2].Error loading library [2] or finding entry point [3].Error getting file attributes. GetLastError: [2].Error setting file attributes. GetLastError: [2].Error converting file time to local time for file: [3]. GetLastError: [2].Path: [2] is not a parent of [3].Error creating temp file on path: [3]. GetLastError: [2].Could not close file: [3] GetLastError: [2].Could not update resource for file: [3] GetLastError: [2].Could not set file time for file: [3] GetLastError: [2].Could not update resource for file: [3], Missing resource.Could not update resource for file: [3], Resource too large.Specified path is empty.Could not find required file IMAGEHLP.DLL to validate file:[2].[2]: File does not contain a valid checksum value.User ignore.Error attempti@H C5BErEx3IQhxL$8iSL$( L$0RSPm\$PD$4;uL$PT$TQSRhPhL$(;t&zt!L$$D$H L$D$H [D$P@PD$T2;uL$$D$H;tOFD$4;uL$PT$TQVRhPhL$(;Vt2"L$(;D$Htjo L$D$H;d VL$,;D$Hu!;tj1 MZ@ !L!This program cannot be run in DOS mode. $zy)y)y)f)y)ie)y)f)y)y)y)f)y)y)y)Y)y)Y)y)Richy)PELz8! pPn<@P.textfp `.rdata @@.data`@.reloc @BL$D$H;<0;tj L$D$H;tj L$\$HjL$4l$LL$@_^][d <QSUVt$D$ W3PUhȠVl$ 6D$@PD$؃;u _^][YL$QShȠV;tS_^][YT$l$RUhVD$@PD$;uS_^][YD$PWhVtSW_^][YWSuhhVP_^]3[YhhV6t_^][YQSVD$W|$PjhȠWD$D$ @PD$؃u _^[YL$ QShȠWtS_^[YT$ D$ RjhWD$ @PD$VuS_^[YD$ PVhW_tSYVS_^[YVSH_^[YjhudPd%D$,SUV3WSL$ D$ @L$\$43$3jID$8L$ Ut#|$ ͋Ѿ$UL$ zD$ ;uPhL$u%L$\$4jL$ D$8@D$ ;uL$T$QSRhPhL$(;Ë|$ȈAUUU ][;uj][E w;sjSpVt$W}ȋŃM_]^ ][D$AISVW|$v F3;t*H:t#t;_H^^^ ^2[L$;uV:tA;t,H@:tL$$^]t+AtHu[Ãr 3˿~3σtJ2t#2t2t 2t_B[ÍB_[ÍB_[ÍB_[ËD$XjtYt<3Ɋ %- u o3rTX&>3;u,9 ~ 9 u;L  uQAYjX US]Vu W}u =&tu"\t WVSЅt WVSu3NWVSBE u u7WPStu&WVSu!E } t\tWVSЉE E _^[] t u=ut$h YYVt$t=j VOYYtVPmj  ^j YVj5 \^VD$tV1Y^VW|$ ́7@PYFYt 7P!YYF_^VW|$ ́GFt%wQ@PYFYtwPYYGF_^ýt qYËAuԁ̋L$tAt@u~Ѓ3ƒtAt2t$tt͍AL$+ÍAL$+ÍAL$+ÍAL$+jPdPD$ d%l$ l$ PUWVu M};v;xur)$8@Ǻr $P?$H@$?`???#ъFGFGr$8@I#ъFGr$8@#ъFGr$8@I/@@@ @@???DDDDDDDDDDDDDD$8@H@P@\@p@E^_ÐE^_ÐFGE^_ÍIFGFGE^_Ðt1|9u$r $A$AIǺr +$@$A@A0AF#шGNOr$AIF#шGFGr$AF#шGFGFGZ$AIAAAAAAAADDDDDDDDD D DDDD$AAAA BE^_ÐFGE^_ÍIFGFGE^_ÐFGFGFGE^_VC20XC00USVWU] E@EEEECs {ta v|tEVUkT]^] t3x<{SkVS* vjDC T{ v4롸UkjS]]_^[]UL$)APAP]Ujhh0BdPd%QQSVWe3u 9p`tE P`u jXËeeM;$Ujhh0BdPd%QQSVWee0tEjXËeeMI5̫t$YYÃ|$w"t$Yu9D$tt$#Yu3Vt$;50Ww!j Vj  tuj^Vj5 `_^UVuW 9>tE@ft~to}uijVuu V~ tP8csmu,9xv'HItU$Ru uVuuu Pу u uu$Vuuu P jX_^]UE e@E|M;A|^SVucsmW 9K~ub9~u]~uWxl&pl@pjVEEt"YYu9~u9~u ~u9~9~}EPEPWu uJ؋E;E9;|;{wCEC E~dF@ xE~v7u= uM9EME}$uu$u S7uuuuu V ,}Ei}t jVqYY_^[À}u u$u uuuuu V oUQQVWxht!u$u uuuu uus}EPEPWu u$E;EsO;>|C;~>F NHtyu&ju$u VjPuuuu u ,E_^VW|$ GtJxPtAt$N;tQRYYu"ttD$tt t u3jX_^Ujhh0BdPd% SVWe]su};utU~;w|eGDt hSPoMu/YËeM}]uG4u릉sMd _^[ËD$8csmt3U} S]VW} tu SWu},uuWu,Tu$6uuWFhu(@Gs uuWu,tWP_^[]Ujh(h0BdPd%SVWe]]ԃeu FE4@lE)@pE}xlMHpeEu uSuVEԃeM:EԋMd _^[unYËeejEP6YY3ϋu }E؉FMHlMHp?csmu)u# u}u}tNPWYYËD$8csmuxux u xujX3Ujh@h0BdPd% SVWeMAuxkA`U | etDujv\YY0jWfYYFMQPYYutR]jsYYjWYYvsW ~V뗃~]jsu:YYjWYYt~vVsYYPWb f~YYtVjWYYtHvYt;tjFPsYYPvW?FPsYYPvWMMd _^[jXËe0UjhPh0BdPd%QQSVWeEtHIteQpMMd _^[38E ËeL$Vt$Qƅ| 42I ^USQE EEUuMmVW_^]MUuQ]Y[ Vl@t:jtjKYYt)V5@htV4YdNjX^3^\@tPp @ËD$@P8@VW5@xu?jtjYYt&V5@htVYdNjpYWt_^á@Vt$u PxtlF$tPeYF(tPWYF0tPIYF8tP;YF@tP-YFDtPYFP=8tPYVYj5@h^V5|55x5h5H^VW=8Dt+t#xthtHt P6Y|5h5x55H_^UEVWjYujYj>YWu |>Yj Y_6^]UE4D]̋T$L$u<:u. t&:au% t:Au t:au uҋ3Ð@ËtB:uA ttf:u t:au tVt$8csmuxux uxtPYt Vx3^hOx5xáTth0h hhjjt$  jjj Wj_9=ut$P|$ S\$=uuN@u NNC|5@@_^[SVW@t7;s!_ {tS8$$;r6a&Y@|_^[S39HVWu53:t<=tGV5YtPY;5uj Y=8t9UWYE?=t"U[;Yuj YW6uYY8u]5Y_^D[UQQS39HVWuhVSX58tEPEPSSWMEMP;ujYEPEPEPVWEH5_^[UMESV!uW} Et7} 8"uDP@"t)t%t tF@tՊFt&F8"uF@CtF@t tF@ t t ūuHtfe8 t u@8t7} UE3ۀ8\u@C8"u,u%39}t x"Pu}} 39U‰UKtCt\FKutJ}u t? t:}t.ttF@Ft@@Xt&Ft'E_^[]QQīSU-ĀVW333;u3Ջ;t ī(;ī;u Ջ;f9t@@f9u@@f9u+Ƌ=SS@SSPVSSD$4׋;t2U(;YD$t#SSUPt$$VSSׅut$Y\$\$VSuL;u ;t<8t @8u@8u+@UY;u3 UWV W3_^][YY3j9D$hP̀ tu5 Ȁ3jXS39U-\~DVW=Ѐp h@h6hj6vj5 ՃC;|_^5j5 5 Ȁ][át u*=u!hȫYthYUU3ɸ;t A=0|V;u =\hPju\h4PVYY\WP\@Yu;uM; u%MB_^[á VW3;u0DPP5W5 ;ta hAj5 4`;ljFt*jh hW;ljF uvW5 \3N>~F_^UQMSVWqA3ۅ|Cj?iZ0DE@@Jujy hhWup;wEPj^Vh̅VDtEPVhȅVSHjXܬu$E;uuuu uPH9]uЬESSuu E @PuE;tc]<ǃ$euWSVe jXËe33M;t)uVuu ju;tuPVuD3e̋Md _^[ËD$L$ ȋL$ u D$S؋D$d$؋D$[Q=L$r-=s+ȋą@P̍B[Í$d$3D$ST$t B8tфtQu WV ؋ ~333ƃu%t%uu^_[3ËB8t6t8t't8tt8tt^_B[ÍB^_[ÍB^_[ÍB^_[%L̍M阨MEP胸YÍM靭xн̍Mh黽̍MHM鐴EP3YÍMMEP YÍM:mMMP0S̸`C̍MاEP˷Yø ̍M鸧  ̍M餧ȉ̋M̋M8ϼ̋M`黼̋M駼̍M@铼̋MbRDvԌ r(ƍ؍".8HVȎܐ2:JXjʏ &~BRbr̐I`/./string too long...0.0invalid string position111v206csm `=?>Unknown exceptiondCPCTCCCCHHItI~IKK.L7Lruntime error TLOSS error SING error DOMAIN error R6028 - unable to initialize heap R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data abnormal program termination R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point not loaded Microsoft Visual C++ Runtime Library Runtime Error! Program: ...SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecGetLastActivePopupGetActiveWindowMessageBoxAuser32.dllXq\q rrssx(@PxСȆС؆ DxP 0u8u@uKu ؇`u uuuuuu Puu 9"@؈ uu @vx =//hHu/ $v 8vhH. XLv `v tvС0hH]0Њ v 8v*bRDvԌ r(ƍ؍".8HVȎܐ2:JXjʏ &~BRbr̐IFindFirstFileAlstrlenAWaitForSingleObjectCloseHandleLocalFreeDCreateProcessAlstrcpyALocalAllocGetLastErrorKERNEL32.dllUSER32.dll[RegCloseKeyrRegOpenKeyExA{RegQueryValueExAgRegEnumKeyExAADVAPI32.dllSHELL32.dllMsi.dll/RtlUnwind RaiseExceptionGetCommandLineAtGetVersionHeapFreeHeapAllocGetCurrentThreadIdTlsSetValueTlsAllocTlsFreeqSetLastErrorTlsGetValueInitializeCriticalSectionUDeleteCriticalSectionfEnterCriticalSectionLeaveCriticalSection}ExitProcessSetUnhandledExceptionFilterTerminateProcessGetCurrentProcessHeapReAllocHeapSizemSetHandleCountRGetStdHandleGetFileTypePGetStartupInfoA$GetModuleFileNameAFreeEnvironmentStringsAFreeEnvironmentStringsWWideCharToMultiByteGetEnvironmentStringsGetEnvironmentStringsWHeapDestroyHeapCreateVirtualFreeWriteFileVirtualAllocIsBadWritePtrIsBadReadPtrIsBadCodePtrGetCPInfoGetACP1GetOEMCP>GetProcAddressLoadLibraryAMultiByteToWideCharLCMapStringALCMapStringWSGetStringTypeAVGetStringTypeWz8t8Ph pёDPAPPDISC.dllgetDpUninstallerPathisApplicationInstalledisIISInstalledlaunchDPUninstallerlaunchUninstallertestDpAppInstalled$()`--07l*P;P\setup.exeLocationDpUninstaller\Software\Product KeyFALSEDP_APP_INSTALLEDTRUEDP_APP_CHECKCOMPANY_APP_CHECKIIS_MINOR_VERSIONMinorVersionIIS_MAJOR_VERSIONMajorVersionSoftware\Microsoft\InetStp.?AVArrayOutOfBoundsException@@out of bounds.?AVexception@@.?AVlogic_error@std@@.?AVlength_error@std@@.?AVout_of_range@std@@ .?AVtype_info@@OuPCOH`0        ! 5A CPR S WY l m pr   )     h Dă`8Ȃxyzpl\ x pPSTPDT̥ ;Zx0Nm:Yw/Ml`y!@~ڣ @ڣ AϢ[@~QQ^ _j21~ ((((( H .0r0w00000 11'171E1U1k11112g2w22#334r4w44444!5x555&6:6S6l666677}77888)9a9f9{9999:]::: ;/;t;;;<[<{<<< =g=> ?A? 1U2 3E33344!4R44h55D6S7777%8888888 9!9_9f9|99999:>:|::;;;]<'>2>L>n>>>>>>?N?a?v????00"0K0S0^0p000001 11"1419111222|33455:6T6]6y66667 7&7<7B7G7S7_777777888888E8k888888888888899j9u99999999:$:(:,:0:4:8:<:@::::::;;;;;;;;;< <$<2<:<@<<<< ==7=z====/>G>(?@?G?O?T?X?\????????????@2080<0@0D000000001+1]1d1h1l1p1t1x1|111111133o3t3334>4D47788::;;<<<<<="=(=5=E=K=S=q=w=====$><>B>K>Q>Y>a>i>u>z>>>>>>>>>>>>?7?G?M?P(00+01060=0C0I0T0Y0c0h00000000001 11.141122j2p2|2224 4,4@4r4y444445$5N5\5555555666F66666666647;77788899'979v999:;:B:S:Y:i:p:w:::::::::::!;.;<;G;Z;;;;;<<, ??)?.?=?C?S?^?p?????????????`00J002223 33&3,363<3A3G3W3`3z333347788O8w8}8888899"9.9`9r999999999:::%:-:8:f:r:|::::::::::;;;;;;;;<l>t>y>>>>>/?4?Q?W??phN0S0r000000000 1)111122W2222222233&3>3^3335T5i555566-6A6U6i6}66611 1$181<1@1D1H1L1P1T1x1111111111112222 20282<2D2H2T2X255555556(6@6D6H6\6l6p6x6|6666666666677,7<7@7D7\7l7p7777777778 888$8,888T8\8h8p888888899(9D9L9`9l999999999999:: :,:4:@:\:h::::::::::::; ;<;d00 0000$0(0,0@0@1x111122 20242H2h2x224444444444445 555$5,5L6P677?<99993331065339:<<>@@@@@><<<:8888<<=?AAAAAAAAAA???=884468;<AABBBBBBBBBBBBBBTTT f f f f f f f f fa]]XTTX]] f f f f f f f f f f f f g g g g g g g g g f f g g g\\WRRW\\gggggggggggfggggggggggga[[OOO[[agghgggggggggghgggggggYYSMMZZahhhhhhhhhhhhhhhhhhhXXPIIPXXhhhhhhhhhhhhhhhhhhWWFFFWW`iiihhhiiiiiiiiihVVMDDVV_iiiiiiiiiiiiiiiUUKAAKU_iiiiiiiiiiiiiiSSH>>HSSiiiiiiiiiiiii]RR;;;RR]iiiiiiiiiiii\PP889PPPiiiiiijjjiiiOOO56EZ o ~&P&PM77000007777;???=;;98887678      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BM6(: R  &P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&PM77;?????????74444:::=@@@@@@@@@@><<=9999===?><=:899==?@???=<<>???BBBBBBBBBBBBBBBCKQNUTTTX]] f f f f f f f f f f f f f f f f f g g g g g g g g g\[WRRW\\ggggggggggggggggggggggga[[OOO[[aggggggghgggggggggghhgYYRLLRYZhhhhhhhhhhhhhhhhhhh`XXIIIXXhhhhhhhhhhhhhhhhhhWWNFFNW_iiiiiiiihhhiiiii_VMDCMVViiiiiiiiiiiiiiiUUKAAKUUiiiiiiiiiiiiiiSSH>>HSSiiiiiiiiiiiii]RR;;;RR]iiiiiiiiiiiiPPD888PP\ijiiiiiiiii]PPB5DY n }&P&PM??????;7754-,++.444;????@@@@@@=:::44447:::@@@@@@AAAA:88411359==?BBBBBBBBAA???>===???@BBBBB<<<777==@CKTTT f f f f f f f f f f f f f f f f f g g g g\\WRRW\\ g ggggggggggggggggggggggg[[UOOU[aghgggggggggghgggggggg`ZZMLRYYggggghhhhhhhhhhhhhhhXXIIIXX`hhhhhhhhhhhhhhhhh_WWFFNWWhhhhhiiiiiiiiihh_VVDDDVViiiiiiiiiiiiiii_UUAAAUUiiiiiiiiiiiiii^SH>>HSSiiiiiiiiiiiii]RR;;;RR]iiiiiiiiiiiiPPD88DPPiiiiiiijjiiiOOO5<E n v }&P&PL{55547;9888;;;??777700004888<@@@@@@@@@@:::74447877:88:<<>AAA?===999;===BBBABBBBBB@???=776445<=@CCCCCCCCCCCCCTTT f f f f f f f f f f\\WRRW\\ g g g g g g gggggggggggggggggg[[UOOU[[gggggghgggggggggghhgg`YYLLLZZaggggggggghhhhhhhhhh`XPIIPXXhhhhhhhhhhhhhhhhhhWWNFFWW_hhhhhhhhhiiiiiiiVVLCDMV_iiiiiiiiiiiiiiiUUKAAUU_iiiiiiiiiiiii^SS>>>SS^iiiiiiiiiiii]RR;;;RR]iiiiiiiiiiiiPPD88DPPiiiiiiiiiiiiPPB5<Y m }&P&PL~////))),0555:??????????88881111888<@@A@@@;;9722741558;;;AAABBBBBBB===;999===?BB?<<9779<:??==>>@@@CCCCCCCCCCCCCCCCTTN[VQQV\\ g g g g g g g g g g g ggggggggggggg[[UOOU[[hgggggggggghggggggggggZZSLLRY`ggghhhgggggggghhhhh`XXIIIXXhhhhhhhhhhhhhhhhhh_WNFFNWWhhhhhhhhhhhhhhii_VVDDMVVhiiiiiiiiiiiiii_UKAAKUUiiiiiiiiiiiiiiSSH>>HS^iiiiiiiiiiiiiRRF;;RR]iiiiiiiiiiiiPPD88DPPiiiiiiijiiiiOOB5DY u }&P&PM=???????5555,,,,0555:???@@@@@@<8881---0006;;@@@AAAAA;;;5556<<<?BBBBBBBBB?=:84//188:BBBBBBBBBC@@@?>>>@@@CCCCCCC<<8569==DUU^ g g g g g g g g g g g g gggggggga[[OOO[[ggggghgggggggggghhgggg`YRLLSZZgggggggghhhgggggggghXXPIIPX`hhhhhhhhhhhhhhhhhhWWFFFWW_hhhhhhhhhhhhhhhhUUMDDVV_iiiihiiiiiiiiiiUUAAAUU_iiiiiiiiiiiii^SS>>HSSiiiiiiiiiiiii]RF;;FRRiiiiiiiiiiii\PD88DPPiiiiiiiiiiiiPOB5DX t |&P&PLz))4444??????????5555,,,,666;@=;;7779<97881111889=AAAAAAAAA?<<96669<<?<<9777<<?B===999;==?BBBCCCCCCCA@@>>>8:6458<<CDDDDDDDDDDLVV^ g g g g g g ggga[[OOO[[aggggggggghgggggggggghhZYLLLYY`ghhhgggggggghhhhggg_WWHIPXXhhhhhhhhhhhhhhhhhh_WWFFNWWhhhhhhhhhhhhhhhhhUUCCCUViiiiiiiiiiiiiii_UUAAKUUiiiiiiiiiiiiiiSSH>>SS^iiiiiiiiiiiiiRR;;;RRiiiiiiiiiiii\PP888PP\iiiiiiiiiiiOOB5DY t |&P&PM?9444.))).4449?????????8220'''*226;@@AA@@@@@<899111599=AAABBBBBB<642-/149<?BBBBBBBBBB>>=999<>>@CCCCC<<8556::>?>?@ABDDDDDDDDDDEEEEEMVV[[OOO[[agggggggggggggghhggggggYYSMMSY`gggggghhhgggggggghhhXXOHHWW_hhhhhhhhhhhhhhhhhhWWNFFWW_hhhhhhhhhhhhhhhh^ULCCLU^hhhiiiiiiiiiiii_UKAAUU_iiiiiiiiiiiiiiSS>>>SSiiiiiiiiiiiii]RF;;FR]iiiiiiiiiiiiPPD88DP\iiiiiiiiiii\OB5<X l {&P&PM?????????4444))))2113666;;;@@@;666---.776@@@@@AAAAA99911127557779<<BBBB<<<6669<<?BBBBBCBBBB>>>:442118<<CCCCCCDC@@A???AAADDDDDEEE==9559==VV^gggggggggggggggghhg`YYLLRYZhhhgggggggghhhhggggg_XXIIPXWggggghhhhhhhhhhhhhhWWFFNWWhhhhhhhhhhhhhhhhhUULCCUUhhhhhhhhiiiiiiiiUUAAAUUiiiiiiiiiiiiii^SH>>HS^iiiiiiiiiiiiiRR;;;RRiiiiiiiiiiii\PP88DPPiiiiiiiiiii\OO5<D l {&P&PLx&&&2228?????:::61,.1&)))555:@@@@@@@@@<772---167<AAAAA;;863051/22:::BBBBBBBBBB<<<6669<<@BBB;<8558<8><:::>>>CCCDCCCDDDBAA@???=:8559==EEEEEEEEEEMVVggggggggggZZSMLYY`gggghhhgggggggghhhhg_WOHHPX`hhhgggggghhhhhhhhh_WNFFNW_hhhhhhhhhhhhhhhhhUUCCLUUhhhhhhhhhhhhiiiiUUAAKU_iiiiiiiiiiiiii^SH>>SS^iiiiiiiiiiii]RR;;FRRiiiiiiiiiiii\PD88PP\iiiiiiiiiiiOOB5C l s&P&PM??8222###!&+,.:<???????:555****555@@@AAA@@@@677,**,..4;;>BBBBBB>::6222:::BBBBBBBBBB<<51.+-36<CCCCCCCCC@>><::<??ACDDDDD@<<422;8<@ABBEEEEEEEEEEEEEEEEVVWYRLLSZZhgggggggghhhhggggggghXXIIHWWggghhhhhgggggghhhhhWWNFFWWhhhhhhhhhhhhhhhhh^UUCCLU^hhhhhhhhhhhhhhh^UKAAKU_iiiiiiiiiiiiiiSS>>>SSiiiiiiiiiiiii]RF;;FR]iiiiiiiiiiiiPP888PPiiiiiiiiiii\OO5<W l z&P&PM|:::6668::<222,&&&2228??@@@@@@@555/***666;@:::566;;377...388=BBBBBBBBB>::6222::>B;;8558<<?<=:777==@CCCCCCCCCC>??::;88044<<@DDEEECBBA@@ABBCEEEEEEEE<<333<<IVVhhhgggggggghhhhggg_WOHIPX`hgggggghhhhhhggggghWWFFNWWhhhhhhhhhhhhhhhhh^ULCCUU^hhhhhhhhhhhhhhh^TJ@@UUiiiiiiiiiiiiiiiSS>>HS^iiiiiiiiiiiii]RF;;RRiiiiiiiiiiii\PP88DP\iiiiiiiiiii\OB5CW rdddddd&P&PLt   (111?????????8222&&&'333@@@@@@@@@800.$#$+/3;AAAAAAAAA888///388=BBBBBBBB>331((*03:BBCCBBCCCC@==777:==CCCCCC<<832489;;=??DDEEEEEEEEEBBB@@@B>;7337<@EEEEEEEFFOWV^ggggghhhXXHHHWWghhhhhgggggghhhhhhg^VMEFNW_hhhhhhhhhhhhhhhhh^ULCCUUhhhhhhhhhhhhhhhh^TJ@@TThhiiiiiiiiiiiiiSS>>HS^iiiiiiiiiiiiiRRF;;RRiiiiiiiiiiii\PD88DP\iiiiiiiiiiiOO55C k z.b|z6*0#-!+"@e&P&PM???111*###*111????????@933-'''30055558;;A@@556+++066;AAABBBBBB888///863;5558;;BBB::6223;;>CCCCCCCCCC==:7002.08<<DDDDDDD??=;;<@@BEEEEEEE@<<21177@ABBEEEEEEEEFFGGFFFFVQRXIIPXWggggghhhhhhggggghhh_WNEEVV_hhhhhhhhhhhhhhhhhUUCCCUUhhhhhhhhhhhhhhhhTT@@@TThhhhhhiiiiiiiiiSS>>HS^iiiiiiiiiiiiiRR;;;RRiiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<W r zCa~{y~aW5(1$.!*'e&P&PL}7?????????111*###1118?@@@=::7/*-0#%'-44:AA@@@AAAA666+++666BBBBBB>;;1--.*,/88=BBBBBBBBB?;;2337;;CCCC?;;33386=777===DDDDDDDDDEB@@<<<@8:7337<@EEEEEBBA@@ABBEEEFFGGG@;6116<AWWWgggggghhhhhhggggVWNFFWWhgggghhhhhhhhhhhhhUUCCLUUhhhhhhhhhhhhhhhhTT@@@TThhhhhhhhhhiiiiiSS>>HS^iiiiiiiiiiiiiRR;;FR]iiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<W r!>`U2$0!.+)&&P&PN)$ ///7????????8111   #))3::@@@@@@@344'''-34AAAAAAAAA;660+(&2+05;;>BBBBB=88///388BBBBCCCCCC;;4--'--8;?CCCCCCD@==777:==DDDDEEE@<<1//44<>@@EEEEEEEEEEEBBA@@AC:;221;;FFFGGGGGGFNVVghhhhhhWVEENWWhhhhhgggghhhhhhhhhUUCCLU^hhhhhhhhhhhhhhhhTT@@JT^hhhhhhhhhhhhhhiSS>>HS^iiiiiiiiiiiiiRR;;FR]iiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<W r!>A6LAMAoe0"1"0!-+(I&P&PP e e eXLB6)$ '//79994446::011###*118@@@@AAAAA43-'''444AAA:;;555624+++066BBBBBBBBBB883//389>CC;;333;;8;;433;;?CCCDDDDDDD==:77:67733<<@EEEEE@@><<>@@EEEEEEEE?:://48=BDCDFFFGGGGGGFFFFFGOLLFFNV^gghhhhhhhhggghhhhhUUCCLU^hhhhhhhhhhhhhhhhTT@@JT^hhhhhhhhihhhhhhRR=>HS^iiiiiiiiiiiii]R;;FR]iiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<V q!>@5K@MAL?H;D70!1"1"/!,:&P&PP e e e e e e e e`\C=7",//?@@@@@@@@111###*229AAAAAAAA:4-(!$).5>BBBBBBBB660+++66<BBBBBBBBB801&$$.16CCCCCCCDD?;;333;<<DDDDDD?;;2-2308;>>EEEEEEEEEEE@@><<>@<:500::@FGGGEDCAAADDEGGGGGF@:5005;AGOWWgghhhhhhhhggghUUCCLU^hhhhhhhhhhhhhhhhTT@@JT^hhhhhhhhhhhhihhRR==GR]iiiiiiiiiiiii]RF;;RRiiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<V q!>?3I>L@K>F9C5>1;._T0"1#3$1#8&P&PP e e`\\XTTT\\\ e e e eLLB6) 008@@@@@@@@@122$$$222::7447::A445(((555BBBBBBBBB<66+++666::6226;;C>99///99>CCDDCCCCC?;<44415022;;?DEEEE>>;88;>>AEEEEEEEE::--+33>@@EEFGGGGGFFFDDDBBB?94//:;AGGGGGGGGGGGXX`hhhhUTBCLU^hhhhhhhhhhhhhhhh^T@@@T^hhhhhihhhhhhhhhSS>=GR]hhhhiiiiiiiii]RF;;RRiiiiiiiiiiiiiPD88PPiiiiiiiiiiiiOO5;V qc5*G;J=I<E7A3=0:,7(4%0"1#3$&P&POTTT\\\ e e e e e e e e e e e e e e e eXLC*% (008@@@@@A=:3((" &229AAAAABBB;55.((.55BBBBBBBB>4.)!#&*66BCCCCCCCC>99//05::CCCCC>;;22051448<<DEEEEEEEEE>>;88;>:::005:?EEEE@@><<@BBGGGGFFFFA;5/.97AACDEGGGGGGGGGGGHHH;;88GT^hhhhhhhhhhhhhhhh^TJ@@TThhhhhhhhhihhhhh]R==HS^hhhhhhhhiiiiiiRF;;RRiiiiiiiiiiiiiPP88DP\iiiiiiiiiiiOO5;V p$f$f#g#g, C8F:G:C6@2;.8*5'2$0"\Q2$4%n&P&PO e e e e e e e e e e e e e e e e e e e e e e e e f f f fMHC*%$,&44::=AAAA222$$$223BBBBBBBBB55.(((205222::>BBB660+,177CCCCCCCCC?::5/).**1;;?DDDDDD<<8448<<EEEEEEEE?:/+)//7>>EEEEEEEEEEEBB@>>@B7://0;;GGGGGDCDBBBDDEGGGGG:;..4;AHHGGXX`hhhhhhhhh^TJ@@TThhihhhhhhhhhhii]RG==RRhhiihhhhhhhhiiRR;;FRiiiiiiiiiiiii\P88DP\iiiiiiiiiii\OB5B p1$1$1$*D1$1$1$1$$e$e1$1$1$1$1$1$1$$f*E1$1$1$#f*E1$1$1$1$1$1$#g#g1$1$1$*F*F1$1$1$1$c9-B6E7B5>0:,7)3&1#/!. -\QbX¾¿&P&PP e e e e e e e e e e e e e e e e e e e e e e e e f f f f[[VQQUG?4*!!119AAAAAAAA922$$$+33BBBBB>::2-(0#%(55;BBBBBBBBC771,,177CCCC?;6215334/05:?DDDDDDDDEE<<8448<7:000::EEEE>>;88;>>EEEEEEGGG;;--033?BBGGGGGGFFFGGEDDBB68,-4;AHHHHHHHGHHHHHXX`^TJ@@TThhhhhhihhhhhhhh]SH>=RRhhhhhhiiihhhhh\Q;;FR]iiiiiiiiiiii\PD88P\iiiiiiiiiii\OB5B iw1$1$1$1$$e*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f*E1$1$1$1$1$1$1$1$1$*E1$1$1$1$1$1$1$1$*F*=2@3A3=/9+6(3$0". ---,e&P&PP e e e e e e e e e e e e e e e e e e e e e e_[[QQQV[[ f f e e e e f fYHC*%!111AAAAAABBB33+" '''2::>BBBBB;55(((55;BBBCCCCCC77.&&$));;DDCCCCC?::000::?DDDEEEE?:6**(,0<<@EEEEEEEEEE>>;88;>>:;005;AGGFFBB@>>@BDGGFFGGG::..38>BCCEEHHHHHHGHHHHH:3,,:DX`hhhhhhhhiihhhhRR==HSihhhhhhhhhiiih\QE::Q]iiiiiiiiiiiiiPD88PPiiiiiiiiiiiiOO5;Vw$e1$1$1$1$1$1$1$1$*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f#g1$1$1$1$1$1$1$1$1$1$1$1$*E1$1$1$*F*F1$1$1$1$.#;.>0<.8*5'2#/!. --,,,-"@&P&PP e e e e e e e e e e e e e e e e eZZUPPP[[` f f f f f f f f e e e f f f f f f fYLC6%!)11BB>::222:/1+$$+33:BBBBBBBB;55(((55<CC::5115:482--288CCCCDDDDD?::000:77500::?EEE@<<444<<@EEEEEEEEE93*(+08@CGGGGFFFGGGDBB>>>A79..4:@GGGGGHEEDCCDEEHHH::,,3:AHHHIIIIXX`hhhiiSR==GR]hhiiihhhhhhhhiRF::QQhhhiiiiiiiiii\P88DP\iiiiiiiiiii\OB;V p1$1$1$1$*D1$1$1$1$1$*D1$1$1$1$*E$f$f1$1$1$1$1$1$#f1$1$1$1$1$*E1$1$1$1$#g1$1$1$1$1$1$1$1$*Fc1&8+;-7)4&1#/ . --,,---/#&P&PP e e e e e e e e e e eZZZPPPUZZ e e e e f f f f f f f f f f e e e f f f f f f f f f e e e fG7. ))>BBBBBBBB33+$$$33BBBBBBBBB;0,"),3CCCCCDDDD882,,17>DDDDDDD::,))))1;;EEEEEEEEEE@<<448<<?93..39?EFC@@:::@@CFFGGGGGG::,*138>BBDGGGGGHHHHHHEE66))17AHHHHHHHIIIIIIIIAI?9=R]hhhhhhiiihhhhh\Q:;FR]hhhhhhiiiiii\PD88P\iiiiiiiiiiiiOB5B iv1$1$1$1$$e*D1$1$1$1$$e1$1$1$1$*E1$1$1$1$#f#g1$1$1$1$*E1$1$1$1$*E1$1$1$1$#h1$1$1$1$1$c2&5(7(3%0"/ . --,,-,- - -!ÿPE:/&P&PP e e e e e_ZZUPPUZZ_ e e e e e e e e e f f f f f f f f f f e e e f f f f f f f f`YYMNNZZ` fMH7*!)11BBBBBBBBB33+$$+33B99111::><55(((55CDDDDDDDC=77---526005:?DEEE@;6116;;EEEEEEEEE?1,%#+.6<EEEEFGGGGGC@@:99@@::..4:@GGGGDBB>>@BBGHHHHA:,,3:AFEDCCDEEHHHIIIII:2++::JJIXX`hhhhiiii\QE::Q]iiiihhhhhhiiiPP88DPiiiiiiiiiiii\O5;U o*D1$1$1$1$1$1$1$1$*D$e1$1$1$1$1$1$1$1$#f1$1$1$1$*E1$1$1$1$#g1$1$1$1$1$1$1$1$1$%/#2$3%1"/!. . --,--- - .!."aXXM>3&P&POZZUPPPZZZ e e e e e e e e e e e e e e e f f f f f f f f f f f e e f f f`ZZNNNZY_ f f f f f f f f f f fMH7*!)11BBBBBBBB9*( %*3BCCCCCCCC<5.()/66DDDCCC>:5,(2&)-88DDEEEEEEEE;;6116;@?93..99EEE<<844<=BGGGGGGGGG:6)'*/8@@GGGGGGGGGGGBB@?950),::HHHHIHHHHEEDCCDF9:++2:IIIIJJIIIIIIXYaRR;:QQhhhhiiiiihhhh[PD8DP\iiiiiiiiiiiiOB5B i*D1$1$1$1$1$1$*D$e1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f1$1$1$1$#g1$1$1$1$#g1$1$1$1$1$1$1$*F%, 0"0"/!/ . --- -- - -!.!/"0$1%~`UB6e&P&POZZZ e e e e e e e e f e e e e e e e e e e e e f f f f f f f f f f f_YZNNNZZ` f f f e e f f f f f f f f f f f f f f f fMH7*!)/-911199BBB33+$%,4;CCCCCCCDD66/)))0*//::DDDDD>82--399EEEEEEEEE?/+!!)/;@EEEEEEEEE@<=566>>G::..4:@GGG@@=::@@CGGGGGGG92,,77A??ACEHHIHHHHHHH@90)/6=FFGIIIIJJJIIIIA91)19NY`hhhhhiiiiihOO77PPiiiiiiiiiiii\O5;Uo1$1$1$1$1$1$$e1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f1$1$1$1$#g1$1$1$1$#g#h1$1$1$1$1$*F%*. 0!/!/ . -- - - .!.!."0#0$bYi^h^F;e&P&PP e e e e e e e e e e e f e e e e e e e e e e e e f f f f f fZZTNNNYZ` f f f f f f f f e e f f f f f f f f f f f f f f f f f fXXK812!)19BBBBBBBBC44%%%44;CCDD?:500+0%()66=DDDDDDDDD993--99?993..99EE@;;116;;EEEEEEEFFG62%#'/8>GGGGGGGGGGC@@:::@59,,29AHHHHHECC???DDEHH91**9:IIIGFFDDDFGHJJI99))99JJJJJIIIXX`ii\PD7CO[hiiiiiiiiiiiOB5B h*D1$1$1$1$1$1$*D$e1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f1$1$1$1$#g1$1$1$1$#g1$1$1$1$1$1$1$%(-0!/!/ .!. - - .!."/"0$`Wh^rhpfI?&P&PP f e e e e e e e e e e f f e e e e e e e e e e e fZZTNNTZZ` f f f f f f f f f f f f f f e f f f f f f f f f f f f fXXQKKQX_ f f f f fMC*%!119BBBCCCCC;44%*%0::?DDDDC=66))/66DDDDDEEEE3-&%-9EEEEEEEEEE;;611;;@E?93..::GG>>:66>>BGGGGGGGG@9*(+/4=@AHHHHHHHHHHHFD=2%&.4@HHIIIIIIIIIGFG<5&'/7AIIIJJJJJIIIII89(0AIihhhhiiiiiii\O5;Uo1$1$1$1$1$1$1$1$$e1$1$1$1$1$1$1$1$1$1$1$1$#f*E1$1$1$*E1$1$1$1$#g*E1$1$1$1$1$1$1$1$c',0"0!/!/!.!.!/"/"/#0$rh{qwnLB&P&PP f e e e e e e e e e e f f e e e e e e_YYMMNTZZ f f f f f f f f f f f f f f f f f f f f e f f f f f f f fXXQKKQXX f f f f f f f f f f f f f fYMC*!!22CCC>99//43/-&&-5<DDDCDDDDD66/))06=99..39?EE993--39?EEEEEEEEE@4.$ //GGGGGGGGGGB>>66:>>@92,,9@GGGG@@>;;AADHHHH@92++9@CCA??ADDIIIIIII91))98GEDDEFFJJJJJJI8/''9BKKKKJYY`iiiiOO5A ht1$1$1$1$1$*D1$1$1$1$1$1$1$1$*E1$1$1$1$*E1$1$1$*E#g1$1$1$1$*E1$1$1$1$1$1$1$1$*F1$1$1$1$*FFOF+1"0"0"0"/"0"0#]T}u{~v&&P&PP f f e e e e e e e e e f f eYYSMMMYY_ e f f f f f f f f f f f f f f f f f f f f f f f f f f f f_XXKKKXX f f f f f f f f f f f f f f f f f f f f f f f fMH4 #.9>CCCDDDD55&&&55<DDDDDDDD2+$#17EEEEEEEEEE99---99EE>82,,88E@;6227<AGGGGGGGGGG1+#!+.>BGGGGGGGGHHDAA;;/5&*99IIIHHHHHHDD@@@D=7))19AJJJJIIIFFEDDE?7''/8IIKKKKKKKJJJK8:-<n$e1$1$1$1$$e*D1$1$1$*D$e1$1$1$1$*E$f1$1$1$1$$f$f1$1$1$1$#f1$1$1$1$1$*E1$1$1$1$#g1$1$1$1$1$1$1$1$1$BxZO|}mee&P&PP f f e e e e e e_YYTNNSYY_ e e e e e e f f f f f f f f f f f f f f f f f f f f f f f_XYKKKXX_ f f f f f f f f f f f f f f f f f f f f f f f f f fWWHHHWWMD+&"22;DDDDDDDD<55&&-5193..39?DE>70**07>EEEEEEEEE?2(! ,2EEEEEFFFGG<<222<<GG99,,29GGB>>666>>GGGGHHH@91*/58;;>BEIHHHHHHIII96&&22@DDJJJJJJIIIII8/%%5<DEFFJKKKKKKKA7%*<Soooo1$1$1$1$1$1$1$1$1$*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#g1$1$1$1$1$1$1$1$1$1$1$*E#g1$1$1$1$#h#h1$1$1$1$vsq¾XP&P&PP f f eYYSMMMYYZ f f e e e e e e e e e e f f f f f f f f f f f f f f f f f f_XXKKKXY_ f f f f f f f f f f f f f f f f f f f f f f f f f f^WOHHOW^ f g g g g g g gZI7+"*33DDDDDDD>9&#/5<EEDEEEEEE77***77EE>82,,88F99---99EFFFGGGGGGA5+'/;GGGGGGGGGGB>:66:?61**99HHHHHHBB<<;AADH@91)19AIIIFDB@@BEEJI@8/'/8JJJJJFFEDEFHI88&.IRnooooooooooo$e1$1$1$1$$e$e1$1$1$*D*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#g1$1$1$1$1$1$1$1$1$*E1$1$1$1$1$1$1$1$1$#hoyvt%&P&PONNNSYY e e e e e f f f f e e e e e e e e e f f f f f f f f f f f f f_XXKKKXX_ f f f g f f f f f f f f f f f f f f f f f f f f f f fWWHHHWW f f f f f f g g g g g g g g g g g gMD7&"3-33..99DDD<55&&-55EEEEEEEEE>1&+1EEEEFEEEE?93-.4:@GG@92,,99G<<222<<GGGGGGGGG?8%%%+1??HHHHHHHHIIIEA1.!#22IIIIIIIIIIJJEE;1"#35IJJJJJJJIIIJI5-#+H[ikmnoooooooooooppppp {$e1$1$1$*D*D1$1$1$$e*E1$1$1$1$1$$f*E1$1$1$1$1$#g*E1$1$1$1$1$1$#g1$1$1$1$1$1$1$#h~{y_W&P&PO` f f e e e e e e e e f f f f e e e e e e e e e f f f f f f f f_XXKKKXX_ f f f f f f f f g f f f f f f f f f f f f f f f f f fWWOHHOW^ f f f f f f f f f f g g g g g g g g g g g g g gVV<1%%*3;DDDDDDDDE55&&&55EE>82,-88>77**077FEEEEEEEFF::% $-9GGGGGGGGGA<7227<AG81**8@HHHC?;77;?CHHHIA91(08@BB?<<BBEIIIIIJ8/''8>DD@@@EEGJJJJ@7.*<Mmmkiieegkkmoooooooppppppppppq |Bzwu{!?&P&PP f f f f e e e e e e e f f f f e e e e e e e e e f f f_XXKKKXX_ f f f f f f f f f f f f f g g f f f f f f f f f f f f^WWHHHWW f f f f f f f f f f f f f f f g g g g g g g g g gVVEEMV^ g g g gMD+&"33DDDEEEEEE=5$%0>FEEEEEEE770**77>EEE88++296:4..::@GGGGGGGGGA..%.<GGGHHHHHHHH??7713$)19IHHHIIIIEBB<<<;4/'/8JJJJIIIIGEE@@:5");Rmmmmmmmmmmmkkgggkkmooppppppppppqqqqqq |rizr|%&P&PP f f f f e e e e e e e f f f f f e e e e e eWXXKKKXX_ f f f f f f f f f f f f f f f f f f g g f f f f f f f fWWOHHWW^ f f f f f f f f f f f f f f f f f f f g g g g g^VMEEMV^ g g g g g g g g g g h gZI7&"*4<EE88,,28>55&&.65EEEEEEEEF?70&"""-8?FGGGGGG@::..4:@GG?81**8?G<<722==BHHHHHHH80(%3688<@DHHIIIIIII@8##1.<?CFJJJJIIIJJ@7%+FV^^bffmmmmmmmmooooomkkgggllnpppppppqqqqqqqqqqqrujaqhxpx%&P&PP f f f f e e e e e e e f f f f f eWWPJJJXX_ f f f f f f f f f f f f f f f f f f f f f f f g g f f f^WOHHOWW g f f f f f f f f f f f g f f f f f f f f f f f g^VMEEVV g g g g g g g g g g g g g g g h g g g g gZM2"$'>EEEEEEEE66.&&55EEEE?81**7/8***89GGGGGGGGGG::$$",8GGGGGGGGGA==338=88((08HHHIII@@777@@II8/''8@IIIJCC<<<CCII7.%.M^llllmff___ffimmmoooooooooomllhhhllnppqqqqqqqqqqqrsssss!>*@5H=PEYNaUe[k`rgxow&P&PP f f f f f e e e e e e_XXQKKPWW e e e e f f f f f f f f f f f f f f f f f f f f f f f f f_WWHHHWW f f f f f g f f f f f f f f f f f g f f f f f f f fUUDEEVV g g g g g g g g g g g g g g g g g g g h h g gTTBBKT]NE8'#44EEEEEFFEE=5-&& &88EEEEFFF882++99@GGG?81*189:4..4:@GGGGGGHHH8-"((==HHHHIIIIIIHD@-$&/<IIIIIIJJJJJFC.%1CTlllllllmmmmmiff___ghoooooooooopppplljhhjmmqqqqqqqqqrssssssssss ~%>4NDWM`Vi_si{rz|&P&PP f f f f f eWWWJJKXXX f f e e e e e e e f f f f f f f f f f f f f f f f f f f f fWWHHHWW^ f f f f f f f f f g g f f f f f f f f f f g g f f]UUDDLU^ g g g g g g g g g g g g g g g g g g g g g g gUUBBKT] g g g g g h h gZI8'#+4<FFFE77**0.1''.65EEFFFFFGG@92+")!%88GGGGGGG@::..4::G?80(08@HHB=8338>CIIII@7''/8I@@888@@IIJJJJ7.):Lkab]XXbbgllmmmmmmmmmmigdaadhhoooooppppppppplmkiikmmoqqqrssssssssssstttt ~c/$=3]Tf^ogxoy6&P&PP_XXQKKPWW^ e f f f f f f e e e e e e e f f f f f f f f f f f f f f f fWWOHHOWW f g g g g f f f f f f f f f g g f f f f f f f f f f^VMDDUU] f f f f g g g g g g g g g g g g g g g g g g gTTBBLU^ g g g g g g g g g h h g g g g gZME+%'%07>EEEEFF66&&&66FFFGG?8**104++299GGGGGGGGGG:2$&+HHHHHHHHHHH=>4432!'88IIIIIIII@@<88:3"):PkkkkklllgbbXX^ccmmmmmmmmmnooohhdaadhhppppppppppqqqqmmkiiimnpssssssssssttttttttuud!>%H>LCPGTKWO%TK{6&P&PNKXXX f f e e e e e f f f f f f f e e e e e e f f f f f f f f f f fWWOHHOWW f f f f f f g g g g f f f f f f f f f g g g f f f f fUUDDEVU f f f f f f f f f g g g g g g g g g g g g g g gTTBBKT] g h h h g g g g g g g g g h h h g g g g]SI?@D?,#+44EEEFFFFEE>6.''.'%*88GGGGGG992++99GGGG7/((7?A;5//;;AHHHHHHH7/'!2344>>CIIIIIIII@7"$C=QW^^kkkkllllllllcc^YY^chmmmnnoooooooohhabbiilpppppqqqqqqqqqmmljjjnnpsssstttttttttuuuuuuu &P&PP f f f f f f e e e e e f f f f f f f e e e e e e f f f f f fWWOHHOWW f f f f f f f f f f f g g g g f f f f f f f f f g g g^ULDDLU] f g g g f f f f f f f f f g g g g g g g g g g]TKBBKT] g g g g g h h h g g g g g g g g g h h h gSI??SS g h h hhgMI8'#44FFFFEF>7)$''''/7?GGGGGGGGG@92&! +7GGGGHHHHA;;//5;B7.&/8@IIIIC>9449>CI@7%)G]kkkk^^WQQ^^elllllllmmmmhccYYYcdnooooooooooopliibbbiimqqqqqqqqqqrssspnnjjjnnqttttttttuuuuuuuuuuuvv&P&PP f f f f f f f e e e e f f f f f f f f e e e e e fWWOHHOWW f f f f f f f f f f f f f f f f g g g g g f f f f f f fUVEEDUU f f f f f f g g g f f f f f f f f f g g g g g g]TKBBKT] g g g g g g g g g h h h h g g g g g g g gTT@?IS] g g g g h h hhgggggZI8'#1-0))7>FFGGG77''/7?GGGGG77((3/9++29@GHHHHHHHH?* $;<IIIIIIIIIII>5';Mjjjkkkkkkkkd^^RRX__lllmmmmmmmmmhc_Z[`eeoooooooppppppliibbbiiqqqqqqrsssssssspnokkkooqtttuuuuuuuuuuuvvwwwww &P&PP f f f f f f f e e e e f f f f f f f f eVVNGHOWW f f f f f f f f f f f f f f f f f f f f f g g g g g f f]ULDDMVV g g f f f f f f f f g g g g f f f f f f f f g g]TKBBTT g g g g g g g g g g g g g g h h h h g g g gSS??JT^ h g g g g g g g h h hhhggggggRR5+' #+4=FFGGGGGGG77'''.&((7?GGGGGG99++299HH?7&&77II;;500<<IIIII7.%-K\YZRKKZ[ckkkkkkkkkll__XRR``fmmmmmmmmmnnoee`[[eejoopppppppppqqiiebbeiiqrsssssssssssttqookkkoppuuuuuuuuuvvwwwwwwwwwww &P&PP f f f f f f f f e e e f f f^WWOHGNVV e f f f f f f f f f f f f f f f f f f f f f f f f f g g gVVEDDUU f f f g g g g f f f f f f f f g g g g f f f f f f]TKBBTT g g g g g g g g g g g g g g g g g g h h h h]SI??S] g h h h h g g g g g g g h h hhhgg\RG=GR]hhhgME+#,5>GGGGGG?7(&&''77GGGGGGGGGH99!!(?HHIIIHHHIB<600*'!-K\iiiiijjbZ[LLS[ckkkkklllllle``SSY``mmmmnnnooooojee[[[eepppppppqqqqqqqiiebcgkksssssssttttttttqopnllnppuuuuvvwwwwwwwwwwwxxxxxx&P&PP f f f f f f f f e]VWHHHOWW f f e e e e f f f f f f f f f f f f f f f f f f f f f f fUUMEEMV^ f f f f f f f g g g g g f f f f f f f g g g g f fTTBBBTT g g g g g g g g g g g g g g g g g g g g g g^TJ@@SS g g g g g h h h h h g g g g g g h h hhRR==RRghhhhhhgggggNF,$,52/((7?GGGG?7/''77GGGGG7.&&7892++9:IIHHHIII7.%3CEENWWiiijjjjjkkk[[LLL[[klllllllmmmm``SSS``gnnooooooooooee`[[`eeppqqqqqqqqqqqrkkgddgkkssttttttttttuuuuppnllnqqtwwwwwwwwwwwxxxxxxxyyyyy&P&PP f f f fWWOHGGVW^ f f f f f f f e e e e f f f f f f f f f f f f f f f f f f]UUDDDUV g g g g g f f f f f f f g g g g g f f f f f f f g gTTBBKTT f f f g g g g g g g g g g g g g g g g g g g]SI?@TT h h g g g g g g g h h h h h g g g g g g]R==GR\gggghhhhhhhgggggh\Q1'(55GGGGGGGGG?7/'"&%!.7HHHHHHH@:3,,39A7.%9JiiiiiWWEEEWWjjjjkkkkkkkc[SLL\\dlllmmmmmmmmf`ZTTZaaoooooooooppppee[[\ffkqqqqqqqqrssssskkgddhlltttttttuuuuuuuuupqqnnnrrrwwwwwxxxxxxxxyyyyyyyyyyz&P&POWHHHOWW^ f e e f f f f f f f f f f e e e f f f f f f f f f f f f f fUUDDDUU] f f f g g g g g g g f f f f f f g g g g g f f f f]TTBBKT] f f f f f f f g g g g g g g g g g g g g g g]SI??SS g h h h h h h g g g g g g h h h h h g g gRG==RRhhhggggghhhhhhhgggPP::QQhhhNF,($55GGGGGG>6&!%.((08@HHHHHHIIIA(""2S]hiiiiiiiii`WNEEWWakkkkkkkkkkd\\LLT]]mmmmmmmmmmnnaaTTTaahooooppppppppkff\\\ffqqqrrssssssssssllheehllttuuuuuuuuuuuvwwtrrnnnprrxxxxxxxxyyyyyyyyyyzzzzz{{&P&POWW f f f f f f f e e f f f f f f f f f f e e e f f f f f f f f fUULDDLU] f f f f f f f f g g g g g g g f f f f f f g g g g g]TKBBTT] g g g g g f f f f f f g g g g g g g g g g g gSS??IS] g g g g h h h h h h g g g g g g h h h hRR==GR g h h hhhhhgggghhhhhhhPE::P\hhhhhhhhhh[J9($516&&6>GGGHH88((08@HHI7.(9MghSS??IT^iiiiiiiijj`WNFFOXakkkkkklllll\]MMM]]mmmmmnnnnooohaZTTZabppppppppqqqqqffa\\aghsssssssssstttttllheeimmuuuuuuuuvwwwwwwwwrrpooossuxxyyyyyyyyyyzzzz{{{{{{|||&P&PP f f f f f f f f f f e f f f f f f f f f f e e e f f f fUULDDLUU f f f f f f f f f f f f f g g g g g g g g f f f f f gTTBBBTT f f f f g g g g g g f f f f f f g g g g g g g gSS??IS] g g g g g g g g h h h h h h g g g g g g]RG=GR\ g g g g h h hhhhhgggghhh\Q::EPggghhhhhhhhhhhhhhO<'55GGGGHHHHHH88(3MgggghhhhiTT???TTiiijjjjjjkkXXFFOXXkkllllllmmme]UMMU]ennnnooooooooaaTUUbbippqqqqqqqqqqqggb^^chmsssssttttttttttmmiffimmuuuwwwwwwwwwwwwxxussooorttvyyyyyyzzzz{{{{{{|||||||||&P&PP f f f f f f f f f f e f f f f f f f f f f f eTULDDLUU f f f f f f f f f f f f f f f f f f g g g g g g g g f]TTBBKTT g g g f f f f f g g g g g g f f f f f f g g g gSS??IS] g g g g g g g g g g g g h h h h h h h g gRG==RR h h h h g g g g h h hhhhhggggQE::Q\hhgggghhhhhhhhhhhOC7CO[hh[J9($56HHHHH?6$(8BP999PPghhhhiiiii^TI??TUjjjjjkkkkkkXXFFFYYllllmmmmmmmm]]MNV^^ooooooooooopibbUU[ccqqqqqqqqqrrrsmhh^^^hhnttttttttttuuuuummiffjoowwwwwwwwwxxxxxxxxxttrppptttyzzzz{{{{{{||||||||||}}}}} &P&PtPPPPPPPPPPPPPPPPPPPPONNNNNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPOMMMMOPPPPPPPPPPPPPPPPPPPPPPPPPPMMMMOPPPPPPPPPPPPPPPPPPPPPPPMMMMPPPPPPPPPPPPPPPPPPPPPNMMMNPPPPPPPPPPPPPPPPPPNLLLPPPPPPPPPPNL{LwLwLwMMLwLwLwLPPPPPPMMMMMPPPPPPPPPPPPNMMMMPPPPPPPPPPPPPNMMMMPPPPPPPPPPPPPPNNNNNPPPPPPPPPPPPPPPNNNNNOOOOOOOOOOOOOOOOONNNNNOOOOOOOOOOOOOOOOOONNNNNOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&PP PP BM6S6(@S+lPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP+lPPP P PP PP PP PP PP PP PP P      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~P PP PP PP PP PP PP  | |PP  | | | | | } | |PP  { { { | | | | | | | } | |PP  { { { { { { { { { | | | | | | | } } |PP  z { { z { { { { { { { { { { | | | | | | | | { {PP  z y z z z z { { { { { { { { { { { { { | | z z z z { | } }PP  y x y y y z z z z z z z { { { { { { { { { z y y y z z | | | | | } } }PP  x x y y y y y y y z z z z z z z { { { { z y y y y z { { { | | | } | | | } } }PP  x x x x x x x y y y y y y y z z z z z z y y y y y z { { { { { { { { | | | } | | | } } }PP  w w x x x x x x x x x x y y y y y y y z y x y x x y { { { { { { { { { { { { { | | | } | y y z z zPP  w w w w w w w x x x x x x x y x x y y y y x w x x y z { z z z { { { { { { { { { { | { { y y y z z | | } } }PP  v w w w w w w w w w w x x x x x x x y x v w w w x z y y z z z { { z z { { { { { { { { x x y x x | | | } } | | } } }PP  v v v v v v w w w w w w w w w w x x x x w v w w w x y y y y z y y z z z { { z z { { { x x x x x { { | | { | | | } } } | } } }PP  v u u v v v v v v v w w w w w w w w w w v v v v w x x y y x y y y y z y y z z z { { y w x x x { { { { { { { | | { | | | } } } | z x xPP  } t u u u v v u v v v v v v v w w w w w v u u u u x x x x x x x y y x y y y y z z y z w w x x y z { { { { { { { { { { | | { | | | x x x x z } }PP  ttuu t t u u u v v u v v v v v v v w v u u u v w w w w x x x x x x x y y y y y y x w w w w z z { { { { { { { { { { { { { { | w w w w w } } } } } } }PP  t t s tttuu u t u u u v v u v v v v t t u u v w w w w w w w w x x x x x x x y y v v v v x z z z z z z { { { { { { { { { { y v v v w | | | | | } } } } } } }PP  ssstt t t tttuu u t u u u v v v t t t t v v v w w w w w w w w w w x x x x v u u v v y y y y y z z z z z z { { { { { { v v v v y { { { | | | } | | } } } } ~ } }PP  {rsssssstt t t tttuu u u u u t t t t v v v v v v v w w w w w w w w w w v u u v v x x y y y z y y y z z z z z z { x v v v v { { { { | { { { | | | } | | } } y w w v vPP  zrrrrrsssssstt t t t ttut s s s s u v v v v v v v v v v w w w w w w v t t t v x x y x x x y y y z y y y z z z x u u v x { { { { { { { { | | { { | | | } v u v v y } ~ } }PP  yqqrrrsrrrsssssstt t t s rrst u u u u u v v v v v v v v v v w w t t t t v x w w x x x y y x x y y y z z y t u u u x z z { { { { { { { { { { | | { x u u u v } | } } } } ~ ~ }PP  yqqqqqqrrrsrrrssstsssr r s t t tuu u u u u u v v v v v v v v s s t t w w w w w x w w x x x y y x x y y t u u t y z z z { { z { { { { { { { { { w u u u x | | | } } | } } } } ~ ~ }PP xqppqqqqqqqrrrsrrrssrrrqst t t u t tuu u u u u u v v v vssss v v w w w w w w w x x w x x x y y t t t t y z z y y z z z { { z { { { { { t t t t w | | | { | | | } } } } } } } ~ v vPP wopppqppqqqqrqqrrrssrqqqrttstt t t u t tuu u u u u ussss v v v v v v w w w w w w w x x w x s s t t y x y y y z z z y z z z { { z { t t t t { { { { { | | | | | | | } } } } u u u v ~ ~PP woppoopppqppqqqqrqqrrpqqqrsssttstt t t u u t uu usrrr v v v v v v v v v v w w w w w w w s s s s x x y y y y y y y z z z z z z z t t t t { { { { { { { { { | | | | | | x u u u u } } } ~ ~ ~PP ~ ~nnoooppoopppqqpqqqqrpopprsssrsssttstt t t u usrrrs u u u v v v v v v v v v v w w w r r r s x x x x x x y y y y y y y z z z t t t t { { { { { { { { { { { { { | | x t t t x } } } ~ } } } ~ ~ ~PP |}nnooonoooppoopppqqpqoopprqrrrsssrssstttttrqrrs u u u u u u u v v v v v v v v v r r r r w w w w x x x x x x y y y y y y s t t t z z z z { { { { { { { { { { | w s t t x | | | | } } } ~ } } } ~ ~ ~PP ||nnmnnnooonooopppoppppoooqqqrrqrrrsssssssttqqqr t u u u u u u u u u u v v v v vsrq q v w w w x w w w x x x y x x y y s s s s y z z z z z z z { { { { { { { w s s t w { | | | | } | | } } } ~ ~ } t t t tPP {mmmmnnmnnnoooooooppponnopqqqqqqrrrrrrsssssppqqttt t t u u u u u u u u u u vsqqqs v v v v w w w x w w w x x x y u r s s y y z y y z z z z z z z { { { w s s s w { { | { { | | | | } | | } } s t t t } ~ ~ ~PP zsmmmmmmmnnnnnnooooooonnnopppqqqqqqqrrrrrrsqpppssttttt t t u u u u u u u upqqs v v v v v w v v w w w x w w w u r r s u x y y y y z y y z z z z z z v s s s w { { { { { { | | { | | | | } s r s s } ~ ~ } } ~ ~ ~PP zsllllmmmmmmmnnnnnnooonnmmpppppppqqqrqqqrrrsoopqsssssttttt t t u u u urppp u u v v v v v v v w v v w w w x r q q u x x y y x y y y y z z y z z z r r r v { { { { { { { { { { | | { | w r s s } | } } } ~ ~ ~ } ~ ~ ~PPyyklllllllmmmnmmmnnnonmmmmnpoopppppppqqqrqqqoooprrsssssssttttt t trpppr u u u u u v v v v v v v w v v t q q r x w w x x x y y x y y y y z z q r r r z z z z { { { { { { { { { { w r r r w | | } } | } } } ~ ~ ~ ~ ~ x rPPxxkkkkklllllllmmmnmmmnnlmmmoooopooppppqppqqqponnrrrsrrsssssssttttoopr u u u u u u u u u v v v v v vsq q p t w w x x x w x x x y y y y y u q r r y z z z z z z z { { { { { { { q q r w | | | | | | } } } } } } ~ x r r r x ~PP}wpjjkkkkkkllllmllmmmnnllllnonnoooopooppppqppnnnprqqrrrssrsssssssqooot t t u u u u u u u u u u v v vppps w w w w w w x x x x x x x y y q q q u y z z z z z z z z z z { { { q q q q { { { | | | | | | | } } } } q q r x ~ ~ ~ ~ ~PPvpjjjjjjkkkkkkllllmllmlklllmnnnoonooooppoppponnmqqqrrqqrrrssrssssnnnqtttt t t u u u u u u u u urppp v v v v w w w w w w x x x x x t p q q y y y y y z z z z z z z z z u q q q { { { { { { { | | | } | | | q q q r } } ~ ~ ~ ~ ~ ~ ~PPuviiijjjjjjjkkkkkkllllmkkklmnnmmnnnoonooooppommmoqqqqqqrrrqrrrssspnnnsssttttt t t u u u u u uooor v v v v v v v w w w w w w x x p p p t x y y y z y y y z z z z z z p p p u { { { { { { { { { { | | | w q q q } } } ~ } } ~ ~ ~ ~ ~ ~ ~PPztiiiiiiijjjjjjjkkkkkklkjkkmlmmmnnnmnnnoooooonmmmppppqqqqqqrrrrrrrnnnpssssssttttt t t u urooo u u u u v v v w v v v w w w w s o p p x x x x x y y y z y y y z z u p p p z z z z { { { { { { { | { { q q q w } | | } } } ~ } } ~ ~ ~ ~ q q qPPhhiiiiiiijjjjjjjkkkkiijkllmmmmmmnnnnnnnooolllnpppppppqqqqqqrrrommmssssssssssttttt tnoor u u u u u u u v v v w v v v w o o p s w x x x x y x x y y y z z ypp p u z z z z z z z { { { { { { v q p p | | | } } | | } } } ~ ~ } q q q q ~ ~ ~PPhhiiiiiiijjjjjjjiiiikkllllmmmmmmnnnnnnlllloooopppppppqqqqqqmmmorrrsssssssssstttnnn t u u u u u u u u u u v v v wsnoo w w x w w x x x x y x x y y tppo y z z z z z z z z z z { { { p p p v | { { | | | } } | | } } v q q p ~ ~ ~ ~ ~ ~ ~PPhhiiiiiiijjjihhikkkkkkllllmmmmmmnnnkkklooooooopppppppqqnlllrrrrrrrssssssssspnnntt t t u u u u u u u v u u vnnos v v w w w x x w x x x x y xooo t z z y y z z z z z z z z z u p p p { { { { | | { | | | } } } p p p v ~ ~ ~ ~ ~ ~ ~ ~ ~ ~PPhhiiiiiiihhhijjjkkkkkkllllmmmmmkkkknnnnooooooopppppplllnqqqrrrrrrrssssssmmmpttttt t t u u u u u u u vnnn v v w w v v w w w x x w x x sooo x y y y z z z y z z z z z z o o o u { { { { { { { | | | | | u p p p } } } } ~ ~ ~ ~ ~ ~ ~ ~ ~ oPPhhiiihgghjjjjjjjkkkkkkllllmmjjjknnnnnnnooooooopppkkkpqqqqqqrrrrrrrsspmmmssssttttt t t u u u uqmnn v u v v v w w w v w w w x x soo s x y y x y y y z z z z z z t o o o z z z z { { { { { { { | | p o o u } } } } } } } ~ ~ ~ ~ ~ v o o o ~PPhhggghiiijjjjjjjkkkkkklljijjmmmmnnnnnnnoooooomkkkppppqqqqqqrrrrrrommpsssssssttttt t t ummmq u u v v v v v v w w w v w wnoo s x x x x y y y y y y z z z to o t z z z z z z z { { { { { { o o o | | | | } } } } } } } ~ ~ o o o v ~ ~ ~ ~PPffiiiiiiijjjjjjjkkkkkhiijlmmmmmmnnnnnnnooojjjmpppppppqqqqqqrrrlllosssssssssstttttlmm u u u u u u v v v v v v w w wnnn w x x x x x x x y y y y y yooo t z z z z z z z z z z { { t o n n { | | | | | | } } } } } u n o o ~ ~ ~ ~ ~ ~ ~ ~PPhhiiiiiiijjjjjjjkihhhkllllmmmmmmnnnnnnkjjjoooopppppppqqqqqqlllrrrrsssssssssstplml t t u u u u u u u v v v v vqnnn w w w w x x x y x x x y y ynn n z z z z z z z z z z z z z t n n t | { { { | | | } | | } } n o o u } ~ ~ ~ ~ ~ ~ ~ ~ ~ ~PPhhiiiiiiijjjjjghhikkkkllllmmmmmmnnnkiikooooooopppppppqqnkkkrrrrrrrssssssssoklptut t t u u u u u u u v vrmmq w w w w w w w x x x y x x snnn y y y z z z z z z z z z z n n m t { { { | { { { | | | } | m n n } } ~ } } ~ ~ ~ ~ ~ ~ ~ v n nPPhhiiiiiiijhgggjjkkkkkkllllmmmmmmiiiknnnoooooooppppppjkknqqqrrrrrrrsssssollostttut t t u u u v u uqmmr w v v w w w w x w w x x x smm s y y y y y y z z z z z z z m m m z { z z { { { | | { { | |nn n | } } } } ~ ~ } ~ ~ ~ ~ n n n v ~ ~PPhhiiiiifgghjjjjjkkkkkkllllmmmhhhnnnnnnnooooooopppjjjpqqqqqqrrrrrrrsskkkosssstttut t t u u umllq v v v w v v w w w w x w w rmm s y x x y y y y y y z z z zm m m z z z z { z z { { { | | t m mm | } } | } } } } ~ ~ } ~ n n n ~ ~ ~ ~ ~ ~PPhhiifgfiijjjjjjjkkkkkkllljhhhmmmnnnnnnnooooooojjjppppqqqqqqrrrrrrjkkssssstsstttuu t tlll v v u u v v v w v v w w w wmll r x x y y x x y y y y y y smmm z z z z z z z { { z { { tm m t { | | | } } | } } } } v n m n ~ ~ ~ ~ ~ ~ ~ ~ ~PPfeffijiiijjjjjjjkkkkkkhhhjmmmmmmnnnnnnnoooliijpppppppqqqqqqrrrjjjrssssssstsstttulkk u u u v v u u v v v w w v wlll x x w x x x y y y x y y y rl l s z z z z z z z z z z { { tmm t | | | | | | | } } } } u m m v ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ lPPfhiiijiiijjjkjjjkkkhggllllmmmmmmnnnnnnnliilooopppppppqqqqqmjjjrrrrsssssssttstkklu t t u u u v v u u v v v wlll w w w x x x x x x y y y x rll r y y z z z z z z z z z z smm t { { { | | | | | | | } u m m u } } ~ ~ ~ ~ ~ ~ ~ ~ ~ l l l ~PPhhiiijiiijjjkjjhggglkkllllmmmmmmnnnnhhhloooooopppppppqqmiimrrrrrrrssssssstkjkttuu u t u u u v v v u vkll w w w w w w x x x x x x y rll r y y y y y z z z z z z z sll s { { { { { { | | | | | tlm u } } } } } ~ ~ ~ ~ ~ ~ l l l ~ ~ ~ ~PPhhiiijjiijjjigfhkkkllkllllmmmmmmnhhhnnnoooooooppppppliimqqqrrrrrrrssssnjjktstttuu u u u u u v vkkk v v w w w w w w w x x x x rll r y y y y y y y y z z z z sll t z z z { { { { { { | | t l l t | } } } } } } } ~ ~ ~ l l l ~ ~ ~ ~  ~ ~PPhhiiijjiifffikjjkkkllkllllmmmmgghnnnnnnooooooopppliimqqqqqqrrrrrrrsnjjnssttttttuu u u u ujkk v v v v v w w w w w w w x rll r x y y y y y y y y y y z sll s z z { z z z { { { | { sll t | } | | } } } } } } } l l l ~ ~ ~ ~ ~ ~ ~  ~ ~PPihiiihffejjjkkjjkkkllklllljgggmmnnnnnnnoooooooiiilpppqqqqqqrrrrrmijnsssssttttttuu ukkj u v v v v v v v w w w x wqkl r x x x x y y y y y y y y rkl s z z z z z { z z z { { slk s | | | | } | | } } } } k k k ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ kjPPihgeehjjjjjjkkkjkkkllllifgjmmmmmnnnnnnnoooohhhpppppppqqqqqqrrmiimrssstssstttuttjjj u u u u v v v v v v v w wqlkq w x x x x x x y y y y y rkk r y z z z z z z z { { z rkk s | | { | | | | } | | }k k k } } } ~ ~ ~ ~ ~ ~ ~ ~ j kk  ~PPeegiijjjjjjjkkkkkkklifgillmmmmmmnnnnnnnohhiooopppqpppqqqrqliimrrrrssstssstttjjiuu u u v u u v v v v w v vkkq x x w w x x x x x x y y rkk r y y y y z z z z z z z skk r { { { | | { | | | | } k k k } } } } } } ~ ~ ~ ~ ~jjj ~ ~   ~PPiiiiijjjjjjjkkkkkeffilmlllmmmmmmnnnnngghoopooopppqpppqqmihlrrrrsrrsssttssniiuttuu u u v u u v v v vkjj w w w x x w w x x x x x qkk r y y y y y y y z z z z zjj s { { z { { { | | { | | j k k } } } } } } } } } ~ ~jjj ~ ~ ~ ~ ~   PPiiiiijjjjjjjkkeffkklllmlllmmmnmmnngghnnoooppoopppqpplhhmrqqrrrrsrrssstniinttuutuu u u v v u vjjj w w v w w w x x w w x x xjj q y y y y y y y y y y z zjjj z z { { { z { { { | | sjj | | } } } } } } } } }jjj ~ ~ ~ ~ ~ ~ ~ ~   tPPiijiijjjjkjdeekkkkklllmlllmmmnmfggnnonnoooppooppplhglqqqrrqrrrrssrsmhinsstttuutuu u u vjij v v v w w v w w w x x x wjjj x x x y y y y y y y y yijj z z z z z { { { { { { rjj s | | | | } } } } } } sjj } ~ ~ ~ ~ ~ ~  ~ ~ ~ jj tPPiijiijjgeeejkkkklkklllmmllmmfggmnnnnonnoooppoopgglqppqqqrrqrrrrsmghmstttstttuuuuuoij v u v v v v w w w w w w xjjj x x x x x x y y y y y yqii y z z z z z z z { { { {ii r | | | } | | | } } } sjj s } } } ~ ~ ~ ~ ~ ~ i i i   PPiijjfddgjkjjkkkklkklllmmleffmnnmnnnnoonoooppgggppqqqpqqqrrrrrlhhmrssstttttttuuoiio u v v v v v v v w w w wpij x x x x x x x x x y y yqiiq y y y z z z z z z z {iij { { { | | | } | | | }jj s } } } } } } ~ ~ ~ ~iij  ~ ~   PPicddfjjjjkkjkkkkllklllffflmmmnnmnnnnoonoofggpppppqqqqqqqrrrgglrssssssttttttniiouu u u v v v v v v v wpiip w x x x x x x x x x x yiiq y y y z y y z z z z { qii { { { | { { | | | } |iij } } } } } } } } } ~ sii ~ ~   ~ ~   PPTYjjijjjjkkjkkkkllheeemmmlmmmnnnnnnnoofffopppppppqqqqqqqgggrrrrsssssstttthhnuuuvu u u v v v w v vhip w w w w x x x x x x x xhhi y y y y y y z y y z z qii q z { { { { | { { | | rjj | | } } } } } } } } rhi s ~ ~ ~ ~   ~ ~  shPPJJJJZZjjjkkkkkkheehlllmmmmmmmnnnnnnfffoooopppppppqqqqgggrrrsrrrssstssthhhtttuuuvu u u v v vihh v w w w w w w x x x x xphh x x y y y y y y y z z yii q z { z z { { { { | { rii r } } | | } } } } } }hh r } ~ ~ ~ ~ ~ ~   hh s PPJJJJKKKK[[kkgddhllllllmmmmmmmnnnfeenoooooopppppppqlggqqqrrrsrrrssstmghtttuttuuuvv u uohh w v v v w w w w w w x x xhhp x x x x y y y y y y yqih z z z z { { z { { { {ii r | | | } } } | } } } rhh } } } } ~ ~ ~ ~ ~ ~hhh    PPJJJJKKKKKIGGXckkllllllmmmmmmmeeeonnnooopooppppqkfglqqrqqrrrssrrsmghmsttttuttuuuvvhho v v w w v v w w w w w whhh x x x x x x x y y y yphhq z y z z z z { { z { qhh | | | | | | } } } | rhh r } } } } } } ~ ~ ~ rgg       PPHHJJKKHFFILLLLLT\dlmllmmmmedennnonnnooopooppkfgkpqqqqrqqrrrssrggmsttsttttuutuughh u u v v v w w v v w w wohh x x x x x x x x x x y yhhp y y z z z z z z z { {hh q { { | | | | | | } }hh r } } } } } } } } } ~gg s ~ ~       PPJJHFDDHKKLLLLLLLMMMU]lmhdenmmnnnoonnoooppoffkpqqpqqqqrqqrrrgggrsssttsttttuumgguvv v u v v v w w w v whho w w x x x x x x x x xohh y y y y y z z z z z z qhh { { { { { | | | | | qhh } } } } } } } } ~ }fgg ~ ~ ~ ~ ~     sffPPGEEHKKIIIKLLLLLLMMMNJGHYemnmmnnnoonnoooffeppppqqpqqqqrrqlffsssrsssttttttmggnuuuvv v v v v v w whhh w w w w w x x x x x x xggo y y y y y y y z z z qgg q { { { { { { { | | |gg q } } } } } } } } } qgg } } ~ ~ ~  ~ ~  fg s  PPGJJKKKKKKKJJJKLLMJGHKMNNNNV^mnnnoooneeeppoppppqqpqqqqlfflrrsssssssttttffmuuuuuuvv v v v vnhh w w w w w w w w x x x xogg x x x y y y y y y y zgg q z z z { { { | { { { qgg } | | } } } } } } }ff q ~ } } } ~ ~ ~  ~ rff    PPEEHKKKKKKLLLLKGDDJMNNNNNNNOOOO^fojeeooopppppppqqqqqeflrrrrrssssssstmfftttuuuuuuvv v vggn w w w w w w w w w w xoggo x x y x x y y y y yofg z z { z z z { { { | {fg q | | } | | } } } } qff } } } ~ ~ } } ~ ~ ~ff r      PPJJHFFFKKKLLIFFILMJKKLNNNNNOOOOKHI[`oooopppppppqqefeqqrrrrrrssssssefmtttttuuuuuuvngg v v v w w w w w w w w wfgo x x x x x y x x y y yggp y z z z { { z z { { pgg { { | | | } } | } }ff q } } } } } ~ ~ } } rff   ~     ePPJJKKKKFFDDFILLLLMMMNLKKKNNOKHHKOPQQQX`oppppppjeeqrqqqrrrrrrssseeestttttttuuuuufgn v v v v v w w w w w wnff w x x x x x x x y x xoff y z y y z z z { { z zff p | | { { | | | } } qff } } } } } } } } ~ ~fe r ~ ~   ~    rff PPJJKKKHEEHIGGGLLLMMMNNNNNKEEKOOOOPQQQQQQRahpddjqqqrqqqrrrsrrleesssstttttttuumffuvv v v v v v w w w wffn w w w x x x x x x x yfeo y y y z z y z z z { pff { { { | | { { | | |ff q } } } } } } } } } qff ~ ~ ~ ~ ~    ee r PPCCDEEHKKKLLLLGGHJMMNNNGGGNOLLLMOPQQQQQQRIIIahpqqqrqqqrrrseelssssssttttttmffmuuuvv v v v v v wnff w w w w w w x x x x xnff y x y y y y z z y z zef p { z { { { | | | { |ff } } } } } } } } } }ee q ~ ~ ~ ~ ~ ~ ~  ree    PPDDDDDDKKKLLLLLLLJHICGGNNNNOOOOMLNOQQQLHIRRRRRRbbqrrqqrkeesrssssssstttteemuuuuuuvv v v v vefn w w w w w w w w x x xnen x y y y y y y y z zoee z { { { { { { { | | qff | | } } } } } } } qee } } } ~ ~ ~ ~ ~ ~de r     PPJJKKKKDDDHLLLLLLIFFNIIINNNOOOOOOQOJFFLQRRRRRRRSSS[ckdekrssrssssssstleetttuuuuuuvv vmee v w w w w w w w w w w xeen x x x y y y y y y yoeo z z z { { { { { { {ff q | | | | } } } } }ee q } } } } } ~ ~ ~ ~dd ~       ddPPJJKKKKKKKHEEHHEEIMMNNNNIIJLOOOOOHHLQQNNORRRRRRSSSJJO[crrssrssssssdeltttttuuuuuuveem v v v w w w w w w w wnee x x x x x x y y y y yeeo z z z z z { { { { pee | | | | | | | } } }ee } } } } } ~ } } ~ qdd  ~ ~     qcd PPAAFKKKKKKLHEBBEEMMMNNNNNNOLJJEGGQQQQQQQROOORRRNIITTTSTT\dssssskddstttttttuuuuldev v v v v v w w w w w ween w x x x x x x x y yoee y y z z z { z z { { pe q { { | | | | | | | qee } } } } } } } ~ }cd q ~ ~  ~ ~    rd q  PPJJFBBBKKDEHLLLLLFFFNNNNNNOKGGLJKNQQQQQQRRRROFFNSSTTTTTTTUU\dddkssstttttttuuldluvv v v v v v w w wnee w w w w x x x x x x xeeo z y y y z z z { z zee p { | { { | | | | |dd q }      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ } } } } } } } }dd } ~ ~ ~ ~  ~ ~ cc r   PPJJKKKD;;BLLLLLLLMMMGGGJNFGKOOOOPNLLNQQQRRHHHRRPPPTTTTTTTUOJJU\dssstttttttddluuuvv v v v v v ween w w w x w w x x x x ydd y y y z z y y z z zpdd { { { { | { { | | |dd | | } } } } } } } pcd ~ ~ } ~ ~ ~ ~  bc    qPPJJDDDKKKKCCCLLLLMMNNNFC@GKOOOOOPQQQNLLIHHRRRRRSSSQQQTTTIJOUUUUVV]dttttkcduuuuuuvv v v v vde w w w w w w x w w x xnde x x y y y z z y y zodp { z { { { { | | { pdd | | | | } } } } } pc p } } ~ ~ } ~ ~ ~ pcc ~    qb qPP98EKKLKKKLLLCCCHMMJFFNNNOKHHKOPPQQQQGGIMMORRRRSSSTTTLGGTUUUUUVVVVVV^Yckttuuuuuuvv vmdd v w w w w w w w x x wddn x y y x y y y z z ycdo z { { z { { { { | pc p | | | | | | } } }cc p } } } } ~ ~ ~ ~ pb p       bb q PPJJE@@FKKKLLLMLLD<<ENNNNNOOOOKHILQLGGQQQRROMMORSSSTIINTTRRRUUUVVVVPJJWW^etuuuuuuvddm v v v w w w w w w w xdc x x x x y y x y y y zdd y z z z { { { { { {cd p | | | | | | | | }cc } } } } } } } ~ ~bc p ~ ~      bb PPJJKKKF@@FLLLMDDHMMIDDINNOOOOOOPCBDMQQQQRRRRROMNKHITTTTTTUURRSVVJJPVWWWWWWfmuulcdv v v v v v w w w w wmcd x w x x x x y y y yncd z z z z z z { { { {cc { | | | | | | | | occ } } } } } } } } }bb ~  ~ ~ ~    qbb PPJJKKKLLKE@;@EMLLMNNNNIDEJOOOFFFPQQMIIMQRRRRRRHHKNOQTTTTTUUUUPGGTVVVWWWWWWXXQVduvv v v v v v w w wccm w x x x x x x x y yncn y z z z z z z z {occ { { { | | | | | | ob o | } } } } } } } pbb ~ ~ ~  ~ ~ ~  pb q   paPP==KKKLLGDDLFAAFLMNNNNNNOJA>AOPPPQQQQQMIJRRLGGRSSSTQOOTTTUUIIPVVTSSUWWWWWWJJQXXXgn v v v v v wcc w w w w x x x x x x xccn y y y z z z z z znco { { { { { | | | | ob o | | | } } } } } ob p } } ~ ~ ~  ~ ~ab p    pa p PPKJ==;DDHKLLLMMGABHNNNNNFFJOJEFKPQQQQQQQR@AERRRSSSTTTTOOOIIUUVVVVVVUTTVPIJXXXXXXYYYh vlbc w w w w w w x x x y xbc y y y z y y z z z zobn { { { { { { { | |bb o | | | | | } } }ob o } ~ } } ~ ~ ~ ba ~     pa p PPKFCCG>>>KLLLMMMLNHBBCEEOOOOOOPKFGQQQQKFGRRRJJKSSSTTTTNHHPPPUVVVVVVWWPINTWXXXYXYYYYRJYh w w w w w w w x xmcc x x y y y z y y z zbco z z { { { { { { {bb | | | | | | | | }bbo } } } ~ } } ~ ~ab  ~ ~    pa p PPCGKKKLLL>>>LMMMMNIEECBCIOOOOPPPPQGG?FKQRRRSRRRKKOTTHHNTTUUUQQSVVVVIIPXWWUUUXYXYYJJRZZZ[bi w x w wmbm y x x x y y y z y ybb z z { z z { { { { {bb | | | | | | | | |ab } } } } } } ~ ~ }aa ~    ~   aa p PP;;KKKLLLLLL>??MDEINNNNOICCIOPPPPKFFQGGGRRRSRRRSSI@@PTTTTUUUVVSQKGIWWWXWWWXXUVWJJYYYZZZ[[[[c]bm x x y y x x y y y zba z z z z { { z { { nbb { { | | | | | | |aa | } } } } } } } ~aa ~ ~ ~    ~ `` __PPKK;;CLLLLLLLHD9?@NNNNNOOOOICDQFFKQQQRQQHHMSRRRGGMTTPLLTTUUUVVOIOSQRWWXXWWXXPJIVVWYYZ[Z[[[KK[[jq x y y x x ymbb z y z z z z { { znb n { { { { | | | | |aa | | | } } } } } n`a ~ ~ ~ ~ ~   ``   __ PPKKLKC<<DLHCCHMMNN@@GNNOOOOOJF=DDQQQQRQQRRMIDCGSSSTTTTTLMMUUIIOVVVVWRRSXWWPIPYYYYWVW[[Z[KK[\\[\\\kr ylam y z z z z z z z {nan { { { { { { | | |aa | | | | | } } }o` n } ~ ~ ~ ~ ~ ~ ``     __ PPKKLKKLL;58DLMMMNNNNG@AHOOEEJPQPPEEKQRQQRRLGMMHISSTTTTTTTN@BRVVVVVVWWWXSFGPXXYYYYYYYXQIK[[[\\\\\\]TO_ y y y z z z z z znbn { { { { { { { { |aa | | | | | | | }n`o } } } ~ ~ ~ ~ ~_`       __ PP9BLKBCCLLMD<=MMNNNNNNO>87OOPPQQPQQKEFLQFFLSSSRSIIOTTTTMGNUVRNNRVWVWWWIIXUSSXYYYYYYRKS[XXY[\\\\\SKT]]]dk z z z zma n { { { { { { { { {`a | | | | | | | | n`n } ~ } } } ~ ~ ~`_ ~      __ nPPKB1.KLLLLMMLM===NNNIDEOOOAAAPQQPQQQQLB;FRRSSSSSSSOJJCGMTUUVVVVRNOWOHHXXXXXXSTTYYQIR[[[[[YYYZ\JJS]]]]]]]^lfam z z { { { { { {m`` { | | | | | | |n_ n } } } ~ } } } ~__  ~ ~     ^^ n iPPBBLL9::LLMMLMMNN=55INOOOOOOPBBIQQQEFLRRRFFFSSSSSSMGGOJJTUUVVVVVVOBISWXXXXXXXYYDENYZ[[[[[[[\IHZ\\]]]]]]]KKT^l s z { { { {m`m { { { | | | | |m`n | | } } } ~ ~ }__ ~ ~  ~ ~   __   n iPPKKLLLLL::CMMMMIDDNN=>FOOOOPPPQI<;>QQRRRRRRSFFMSLFMTTTTTJKPVVVVGHOWWSOPTXXXXXIIYZWTUX[[[[[JJ\\]YYZ]]]^JJ^^^^___m {m`m { { { { { | | |m_m | } | | } } } ~__ } ~ ~ ~   ~ ^^   n]PP7KLLLLLLLC::<CINNNNNOF>>OOPPPEEKQIBCRRRRRRSSS@<@STTTTTTTUPKKDGVWWWXWWXTPPYHIYYYZZYZXUU[II[\\\]\\]ZZIK]]^^^____UK\m { { { { { { |m_m | | | } } | } }^_ ~ } } ~ ~ ~  ^^     n]PPbF7ALLLLLM>CC;;NNNNOOOOO>?<DEQQQRQQQCCJSRRLFFSTSFGMTTTTTUNGGPKLWWWXWWXXPHDPUYYYZZZZ[[IFVX[\\\]]\]JJ\[Z]^^^__TJU````f t { {m_m | | | | | } } |^^ } ~ ~ ~ } ~ ~ ~^^      n]PPjjkY?7AGBCMMMNN;;;NOOOOODDK??HQQRQQQRRJD?ELSSSTSSTMGHUTMGNVVVVVLLQXXWPHPXYXUQQYZZZQII[[\XVV\\]]IJ]]]^^[[[^TJT_```````UTf | | | | | | | }^^ } } } ~ ~ ~ ~ ~^^        n]PPjjkkd]J=8MMMMNNNNN;<EODDOPQPPH@@RRQQRREFLCDDSSTSSTTTT::AVVVVVVVWWQMGHPXXXYYYYYQRMIQ[[[[\\[\VWGJ\]]]]^^^^SGQ]__``````JU``an | | | |m^ } } } } } ~ ~ ~ n^ ~ ~      ]PPjj]]dkkkcH8BMNNNNNNI=3<OOPQPPQQQAAIKEERSSRSSDDLTSTTFFUUUIIOVVVVWWGHPMMRXXYYYYYPHMSSW[[[\\\\II]WWZ]]]^^^IS__]\\````JJ````aaahc^m } } } } } } ~ n^ n ~ ~ ~    ] sPP\\kkkkkkkllZ@9NNNH>IOOO<<GQQPQQQRK?=ARRSSRSSSSLE@FFTTUUUVVOIIVVGGWXXXXRMNYYYPHPZ[[[WSS[\\II\\]]]ZWW]^II^^_____]]HJ``a```aaUJVbip } } ~ } m^ n ~ ~ ~ ~ ~  ] hPPjjkkkkkkklllllH1.HOOOOOOOF==PQQDEKRQRAAJSSSSSSMFMEELTUUVVVVVV::PWWXXXXXXXNH?PYYZ[[[[[[SDD\\\\]]]]]]CE[^^^_____JJ`]]^a```UIUcbbbcc pg] m ~ ~ ~ ~  ~ ~] hPPjjkkkkkkkllld]]leH:DOOOOPPQQ74:QRRRRRRRJAAJSEEMTTTTLEFUVVVNFFWWPJJXXXYXXPHPYONSZ[[[[[HI\WTT\\]]]]II]^[XX\___II`````^^^^IUaacbbbccJWc p w ~ ~ ~  m gPPjjkkkkkkkl]]dlllmmmTA:OOPPDDJQG=>HRRRRRSSS=6ASTTTTTTTUFFFFNVVWWWWWKKQYGGPYYYZYSOP[[HH[\\\\]STX]II]]]^^^^\YFI__``````aIH]^aaccbbJJcddcdj q m]PPjjkkkkk\\]llllllmmmnnfI:?>QQQQQQRH>>RRRLEETSSBBKTUTTTUNFFFFVVWWXWWXX@=KXXYYYZYY[[==U[[\\\\]\\DDT]]]]^^^^TI_YY\`````HIa``a^^acIIcccddcddIhPPjjkkc\\kklllllllmmmnnn]]NB;QQQQQRRRR?;DLSSTSSSTKBLTTEFNVVVVFGOWXWWGGXYYKKRYYZZYHH[[UPP\\\\]HH]]]TTX]^^SHT____\ZZ`HH`aaa`aabUG`acccdddIQPPjj\\ckkkklllllllmmme]]nnnngJ;FQQRRRDEK>?ISTTSSTTTL43TUVVVVVVWOHHFFXXXYYXXRKKZGG[[[[[[[QQVHI]\]]]]]XULHS^______`TDZ]`aaaaaTIVcca``cdIQ } PP[[kkkkkkklllllllm\\ennnnnnoooUB;RDDRSRRSI?@TSSTTEFUTBCMVVVVVWWFGHGPXXYYYYYYG?LS[[[[[[[\HEQR]]]]]]]RHSUUV_____SHT``]Z[^aaHUbccccccSM z PPjjkkkkkkklllllc\\mmnnnnnnnoooooUD5GRSSRSSST@@BEETUUTTUMDDVVVFFWXXWPHHYYYYGGYZZTMM[[[[RH\\\]RRW]]]GR]^^^_VV[SHT``````a^DCaabccccUHf PPjjkkkkkkklllc[clmmmnnnnnnnooo\\oppV<<SRSSSTLEB@@TUUUTVVVV;7=WWWXXXXXXIIBGYYYZZ[[[MMJHR\\\\]]]WRAG]]]^^^___DMV_```a``HHaa\\_cccHf PPjjkkkkkkkl[[clllmmmnnnnnnne\\oooppppiD<SSKELTTTT@@JUUVVMEMVMDDWXXXXXXGGQIQYYZZ[[[QGJNN\\\\]]]GG]RRW]^^__HH`__WW[`aTGaaaabb_]FP {  PPjjkkkkkb[[llllllmmmnnnnn[\eoooooppppqqqA*@TTTTTTTUJ@AMEMVVVWWWEENXXFFYYYYQIIZZ[QGQ[[\\NN\\]RG]]]]]WRS^SH__`___`[MBT`aaaabbTP { { { |  PPjjkkkZZbklllllllmmmnnn[[nnooooooppppqg]gq^E=TTTTTUULE=AVVVVWWWWXN7<XXYYYYYYYJDBQ[[[\\\\\NGCR]]]]]]]]R?HY__``__`GSaXW\aaacHd | |  PPjjbZZkkkklllllllmmmd[[nnnnoooooopppf]gqqqqrjL=HTTLDLVVVAAKWWWWWFFXNEEYYYYYYOFQSKK[[\\\\QGRVOO]]]]]QFR^_YSY``_GG``aa`\XXGP } } PPZZbkklkkklllmlllm[[dnnnnnnoooooop\\fqqqqqqrrrrW=5LUUVVVVVKBBWEEXXXXXXFFOYYEOZ[[[[KKS\QGQ\\]]]OOV]FQ]^____YTKG_```aaaaTO o v |   PPjjkkklkkklllmllZ[mmnnnnnnnooooo[\pppqqqqqqrrrg\\_E>UVVVVVVWE9BMXXXXXXYYO73YY[[[[[[[S:I\\\\]]]]]?<O]]^____SGSTTZ``aaTG l | v w   PPjjkkkllkkllldZZlmmmnnnnnnnooe[[oppppqqqqqqrg\grrrskM?JVVVEEWWWMCMXXXXYEEYYFF[[[[[[FG\SKK\\]]]QF]]]OOW___GS````ZTTaGc w w }  PPjjkkkllkklZZdmllmmmnnnnnnne[eoooppppqqqqqf\grrrrrssssY?=DWWWWWWXMCCXEEYYYYYYHHQ[FF[\\\\\KLTQFQ]]]]]]WQ@G__``````SIj x } x x  PPkjkkkllbYZllmmllmmmnnnnnZZeoooooppppqqqf[frrrrrrrssssg[TF?WWWWWXXXE9CNYYYYYY[[G7H[[\\\\\\\BEL]]]^]]]SG_QQ_````SFj x q q x y  PPkjkkkZZcklllmmmlmmmnnnZZnnooooooppppq[[fqqrrrrrrrssg[gsstlN?KWWXEEXXXNCNYYYZPFP[[HH\\\\\EF]]]LL]^]]FS__`_QQX`Fb ~  q r z z {  PPkjbYYlllllllmmmmmmmdZZnnnnooooooppp[[qqqqqrrrrrrrg[gssssttttY?>EXXXXXYYNCCOEP[[[[[[HHREE\\]]]]]LMAE^___`__`KGc ~ ~  z r r { { PPYYbkklllllllmmmmmcZdnnnnnnoooooopZZpqqqqqqrrrrrf[gssssssttttt[UG@XXXXYYYYD>DP[[[[[[\P@HH\\]]]]]QFULM___``RFi ~ ~kk u s s {  { {  PPkkkkklllllllmmmZYcmnnnonnnooopdYZpppqqqqqqrrrf[frsssssssttt[[ttumO@XYYYDDYYZPEP[[[PEP\\\HI]]]QEQ^^]^NNW`Fa ~ ~ ~ ~ ~ ~ umm { s t  | |PPkkkkklllllllcYYmmmmnnnonnnoodZdoppppqqqqqqrf[frrrssssssst[[ttttuuuuOA>DYYYZZ[[PEEEP\\\\\\\II@Q]]^^^^__J>j } ~ ~ ~ ~ ~   mn w t u ~  | } PPkklkkllllmbXcmmmnmmnnnoonndYdpooppppqqqqqZ[frrrrrssssssZ[ttttttuuuugL[HAYYZZ[[[EEEE\\\\\\\EESII]^^^^REg | qfg ~ ~ ~ ~   wn x ~ v v  } ~PPkklkklllYYblmmmmnmmnnnooYYdooppoppppqqqZZqrrrrrrrssssZZstttttttuuuZguvvnHAZZ[PE[[[[FFQ\\PE]]]]]IJ^_E` { { | | } ~gg r ~   wnn w w    PPkkllkbXXlmmlmmmmnmmnnnYYnnoooppoppppqZZqqqrrrrrrrssZZssstttttttuZZuuuvvvvoP<>P[[[[[\\QF?P\]]]]]]^=;g { { { | } } ~ ~ ~ rh s  o o y  w w PPkklXXblllmmlmmmmnnmcYYooonoooppppppYZqqqqqrrrrrrrZZsssssttttttYZuuuuuvvvvvYg\BN\[[[\\DEQFF]]]]]PDf {naa { | } } ~ ~ ~ ~  shi y o p  w x  PPaXXlkllllmmlmmmmncYcnnoooooooppppYYpqqqqqqrrrrrYYsssssssttttYYtuuuuuuvvvhYg v w w\JB[[PD\]\\\GGR^DW z z { { { {ab } } ~ ~ ~ ~    ii u p p {  x x PPaklllllllmmmmmmXYcnnnnoooooooppYYpppqqqqqqrrrYYrrsssssssttfZtttuuuvuuvgYhw v v w w w xp>2P\\]\\\]]E7c y z { { { { { { |ccp ~ ~ ~    ujj { r r  y y  PPkklllllllmmmmXXmnnnnnnoooooodYYpqpppqqqrqqrYYrrrrsssssssfYfutttuuuvuuYgvvw v v w w w xhXpQCO]]\\]D^ yj\] { { { { { { } } }pcc ~    jk r s  z {PPkklllllllmbXYmmmnnnnnnoooodXdpppqpppqqqrqXYrrrsrrssssteYfttuuttuuuvYXvvvvw v v w wgYh w w x x]DP\CK y y y y y z]] { { { { } } } ~ ~ ~dd   kk w s s } { { PPkkllllllbXbmnmmmnnnonnoocXdoopppqqppqqqYYqrrrrsrrsssfYfstttuuttuufYvuvvvvw w v wXg x x x w x x x yN1P y y y y y y z { {]]l | } } } ~ ~ ~ ~ ddr wkk  } s s | |PPkkllllWWbmmmnmmmnnnonnXXcopoopppqqppqXXrrqrrrrssrssXftsstttuuttfXfvvuvvvvw wgX w w x x x w x x xX yaX y y y y { { { { {l^n } } ~ ~ ~ ~   re r lm y  t t ~ } }PPkklaWWlllmmmnnmmnnnoXWooooppopppqqpXXqqrrqrrrrssrXXssttstttuufXfuuvvvvvvvgXg w w w x x x x xh`  jXh y { { { { { { |n__ ~ ~ ~ ~    rff ym z  ~ t u } ~PPkVWalllllmmmnnmmnnXXonooooppopppqXXpqqqrrrrrrrsXXssssttttttuXfuuuuvvvvvvXg w w w w w x x x x[  zXj { { { { { | } } }`` ~ ~    ff u znn  u v  PPVklllllllmmmnnnbWWnoonoooopppppWXqqqqqqrrrrrrXXsssssstttttXXuuuuuuvvvvXXvw w w w w w x xh h |Zj { { { | } } } ~ ~``o   ug u o o { w wPPkklllllllmmmnbWbnnnooooooopppWWpqqqqqqqrrrrXXrssssssstttXXtuuuuuuuvvgXvvvw w w x w wh` bZ | | } } } ~ ~ ~ ~o`o ugg { o o w x PPkklllllllmmWWbnnnnnooooooopWXpppqqqqqqqrrXXrrrssstssstfXtttuuuuuuugXgwvvvw w w x wW c[ } } } ~ ~ ~ ~  oaa hh  p p x yPPkklllllllWWmnnnnnnnooooocWWppqppqqqqqqqXXrsrrrssstsseXftuttuuuuvuWgvvwwvvw w whg m[l ~ ~ ~ ~    ab ii w  p p | y y PPkkllllaVVmmmnnnnnnnooocWcopppqppqqqqrWWrrrssrrsssteWetttuttuuuuXWuvvvwwvvw w_  }\m ~ ~    bb s wjj  | q r z zPPkkllaVallmmmnnnnnnnocWcooopppqppqqqdXqqrrrssrrsssXfsstttuutuufWvvuvvvwwvvWj ~d\    rc s jj  r r  zPPkkVVallllmmmnnnnnnbWcooooopppqqpqdWdrrqrrrssrrsWWttsstttuutfWfuvvuvvvwwgbe] scc jj y  s sPPUUlllllllmmmnnnnVVbooooooopppqqVWdqqrrqrrrsssVWsstttstttuuVfuuuvvuvvvw^ ~ n] dd t  yll t tPPkklllllllmmmnnVVnnnooooooopppWWpqqqqrrqrrrsWWsssstttstttWWuuuuuvvvvvVj o] o te u ll t t PPkklllllllmmaVVnnnnnooooooopVVqqqqqqqrrrrrdWssssssttttteVuuuuuuuvvvff^ p uef l m | u vPPkklllllllaUannnnnnnooooooVVppqqqqqqqrrrdVdsssssssttteVetuuuvuuuvf^ }h` ff  | n n v v PPkklllllTUammnnnnnnnooooUUopppqqqqqqqrdVdrrsssssssttVetttuuuvuuuV | h` ff w n n } PPkklllUTllmmmnnnnnnnooUUooopppqqqqqqcVdrrrrsssstssVVttuttuuuvuee q` r wg x } n ~PPkk`TTmlllmmmnnnnnnnUUooooopppqqqqcUcrrrrrrsssstVUttttuttuuuf] a s  xhh ~ o oPP_S`llmlllmmmnnnnaUUooooooopppqqcUcqqrrrrrrsssdVtsttttuttuuY | jb hi p q PP_klllmmllmmmnnaUannooooooopppcUcqqqqrrrrrrsdUdttsttttuutUd jb ii z q rPPkklllmmllmmmaUannnnooooooopbUcqqqqqqrrrrrcUdssttsttttue` sb u zij r rPPlklllmmmlmTTannnnnnoooooobUbpqqqqqqqrrrcUcssssttttttd\ zc vjjPPlklllmmmSTmmnnnnnnnooooaTbpppqqqqqqqrrUcrrsssstttttX z  l vjk |PPlllll`TTmmmmnnnnnnnooaTaoopppqqqqqqqUUrrrrsssstttUc  le |lmPPlll_S`mmmmmmnnnnnnnaTapooopppqqqqqTTrrrrrrsssstd^  uem mPPlSS_lmmmmmmmnnnnn`SaoopooopppqqqTTqqrrrrrrsssd[ x  ve y m m ~PPSlmllmmmmnmmnnnaT`nooopooopppqTTqqqqrrrrrrssZ x  nf ~ mPPllmllmmmmnmmnSSaonnoooppooppSTqqqqqqrrrrrrTd  nfPPllmmlmmmmnmRSnnnonnoooppooaSpqqqqqqqrrrrSa wh {PPllmmlmmmmSSmnnnnoonoooppaSappqqqqqqqrrb] h {PPllmmlm_RSnnmnnnnooooooaSaopppqqqqqqqbZv  piP      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Pllmm_R_mmnnnnnnnooooRRappppppqqqqqaYv  qiPPllRR_mmmmnnnnnnnooSRoopppppppqqqbYu yPPQQmmmmmmmnnnnnnnRRoooopppppppqqUu PPllmmmmmmmnnnonRRooopooppppqppRb PPllmmmmmmmnnnRRnnooopooppppqR^ PPllmmmmmmm`RRoonnooopoopppR^ PPllmmmmm_Q`nnoonnoooppopR^ PPllmmm_Q_mnnnoonnoooppQ^ PPllmQQ_mmmnnnooonoooR] PPlPQmmmmmmnnnoooooQ] PPPlmmmmmmmnnnoooQ\ PPllmmmmmmmnnnoQ\ PPllmmmmmmmn_V^ PPllmmmmmm^Vo PPllmmmm^Uo PPllmmOZq PPllOZ PPTY PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP PP ^_____PP /I~{y}:/0#.!+&`PP Da~zx}bX6(2%.!*'"=PP ]ʃ}ɿζ3$0". ,)'PP !;@5K@LAoeش׶Ը0"1"0!. +(PP !;@5K@MAM@I3I>L?K>G:C5?2;.նѭý^S0"1"2$2#ۯ<PP 4)F?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~P ';1"1"1"'< '<1"1"1"1"r '<1"1"1"1"'=X tY1"1"Z1"1"1" Z1"1"1"1"1"y!\1"1"1"1")?{1"1"1"1""^}1"1"1"1")@\-"8+;-8*5&1#/!. --,,,--^Tǝ6+PP o1"1"1"1"'<'<1"1"1"1"'< 1"1"1"1"'= Z1"1"1" Z [1"1"1"1"y!]1"1"1"1"{!^1"1"1"1"|)@1"1"1"1"~\2&5(7)4%1#/ . --,,--- - -!ÿyq:/PP U1"1"1"1"1"1"1"1"'< r1"1"1"1"s Z1"1"1" Z [1"1"1"1"1"1"1"1"!])@1"1"1"1"1"1"1"1""_\/#2%3%1"/!. . --,-,- - .!."aWYM>3aPP '<1"1"1"1"1"1"1"q W1"1"1"1"1"1"1"1"1"1"1"1"1"1"uZ1"1"1" Z1"1"1"1" \1"1"1"1"!]1"1"1"1"1"1"1")@\,/!0"/!/ . --- -- - - .!/"0$1%~aVB7 aPP 1"1"1"1"1"1"q W1"1"1"1"1"1"1"1"1"1"1"1"1"1"ZZ1"1"1" Z1"1"1"1" \1"1"1"1"!]!^1"1"1"1"1")@\)-0"/!/ . . - - - -!.!.!/#0$bYh]h^G; aPP V1"1"1"1"1"1"'< W1"1"1"1"1"1"1"1"1"1"1"1"1"1"ZZ1"1"1" Z1"1"1"1" \1"1"1"1"!])@1"1"1"1"1"1"~\(,0"/!/ /!. - . .!."/"0#1%qgpgJ?aPP o1"1"1"1"1"1"1"1"W r1"1"1"1"s 1"1"1"1"uZ1"1"1" Z [1"1"1"1"1"1"1"1"!]!^1"1"1"1"1"1"1"1"~\',0"0!/!/!/!.!.!/"/#0$qg{qxoMCPP ';1"1"1"1"'<1"1"1"1"q 1"1"1"1"'= t1"1"1"1"Z1"1"1"(> [1"1"1"1"y!]1"1"1"1"|1"1"1"1"1")@1"1"1")@\OE+0"1"0"0"0"0"0#^TǺ|r{w;0PP U1"1"1"1"'< '<1"1"1"'< W1"1"1"1"'=s t1"1"1"1"(=Z1"1"1"1"(>w1"1"1"1"1" \!\1"1"1"1")?)@1"1"1"1"|}1"1"1"1""_󵳱ŀx΂z[P҅}цг拃߅~#=PP 1"1"1"1"1" 1"1"1"1"W '=1"1"1"1"1"1"1"1"1"1"1"u1"1"1"1"1"1"1"1" [x1"1"1"1"1"1"1"1"1"1"1"1"{1"1"1"1")@"_1"1"1"1"^~ȼ½葊YPaPP U1"1"1"1"V V1"1"1"1" '=1"1"1"1"1"1"1"1"1"uv1"1"1"1"1"1"1"(>x1"1"1"1"1"1"1"1"1"1"{)?1"1"1"1"|)@1"1"1""_Bxusᕏ&PP U1"1"1"'< '<1"1"1" s'=1"1"1"1"1"(=u v(>1"1"1"1"1"(> \1"1"1"1"1"1"!]1"1"1"1")@}1"1"1""_^|zx韘`WaPP Byvt펇tl{"=PP -Ӓ⬧riyqׂzD:PP Kgޢۦj`pgwnڀw݈ȼWNPP ]*?4G>?<99993331065339:<<>@@@@@><<<:8888<<=?AAAAAAAAAA???=884468;<AABBBBBBBBBBBBBBTTT f f f f f f f f fa]]XTTX]] f f f f f f f f f f f f g g g g g g g g g f f g g g\\WRRW\\gggggggggggfggggggggggga[[OOO[[agghgggggggggghgggggggYYSMMZZahhhhhhhhhhhhhhhhhhhXXPIIPXXhhhhhhhhhhhhhhhhhhWWFFFWW`iiihhhiiiiiiiiihVVMDDVV_iiiiiiiiiiiiiiiUUKAAKU_iiiiiiiiiiiiiiSSH>>HSSiiiiiiiiiiiii]RR;;;RR]iiiiiiiiiiii\PP889PPPiiiiiijjjiiiOOO56EZ o ~&P&PM77000007777;???=;;98887678BM6(: R  &P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&PM77;?????????74444:::=@@@@@@@@@@><<=9999===?><=:899==?@???=<<>???BBBBBBBBBBBBBBBCKQNUTTTX]] f f f f f f f f f f f f f f f f f g g g g g g g g g\[WRRW\\ggggggggggggggggggggggga[[OOO[[aggggggghgggggggggghhgYYRLLRYZhhhhhhhhhhhhhhhhhhh`XXIIIXXhhhhhhhhhhhhhhhhhhWWNFFNW_iiiiiiiihhhiiiii_VMDCMVViiiiiiiiiiiiiiiUUKAAKUUiiiiiiiiiiiiiiSSH>>HSSiiiiiiiiiiiii]RR;;;RR]iiiiiiiiiiiiPPD888PP\ijiiiiiiiii]PPB5DY n }&P&PM??????;7754-,++.444;????@@@@@@=:::44447:::@@@@@@AAAA:88411359==?BBBBBBBBAA???>===???@BBBBB<<<777==@CKTTT f f f f f f f f f f f f f f f f f g g g g\\WRRW\\ g ggggggggggggggggggggggg[[UOOU[aghgggggggggghgggggggg`ZZMLRYYggggghhhhhhhhhhhhhhhXXIIIXX`hhhhhhhhhhhhhhhhh_WWFFNWWhhhhhiiiiiiiiihh_VVDDDVViiiiiiiiiiiiiii_UUAAAUUiiiiiiiiiiiiii^SH>>HSSiiiiiiiiiiiii]RR;;;RR]iiiiiiiiiiiiPPD88DPPiiiiiiijjiiiOOO5<E n v }&P&PL{55547;9888;;;??777700004888<@@@@@@@@@@:::74447877:88:<<>AAA?===999;===BBBABBBBBB@???=776445<=@CCCCCCCCCCCCCTTT f f f f f f f f f f\\WRRW\\ g g g g g g gggggggggggggggggg[[UOOU[[gggggghgggggggggghhgg`YYLLLZZaggggggggghhhhhhhhhh`XPIIPXXhhhhhhhhhhhhhhhhhhWWNFFWW_hhhhhhhhhiiiiiiiVVLCDMV_iiiiiiiiiiiiiiiUUKAAUU_iiiiiiiiiiiii^SS>>>SS^iiiiiiiiiiii]RR;;;RR]iiiiiiiiiiiiPPD88DPPiiiiiiiiiiiiPPB5<Y m }&P&PL~////))),0555:??????????88881111888<@@A@@@;;9722741558;;;AAABBBBBBB===;999===?BB?<<9779<:??==>>@@@CCCCCCCCCCCCCCCCTTN[VQQV\\ g g g g g g g g g g g ggggggggggggg[[UOOU[[hgggggggggghggggggggggZZSLLRY`ggghhhgggggggghhhhh`XXIIIXXhhhhhhhhhhhhhhhhhh_WNFFNWWhhhhhhhhhhhhhhii_VVDDMVVhiiiiiiiiiiiiii_UKAAKUUiiiiiiiiiiiiiiSSH>>HS^iiiiiiiiiiiiiRRF;;RR]iiiiiiiiiiiiPPD88DPPiiiiiiijiiiiOOB5DY u }&P&PM=???????5555,,,,0555:???@@@@@@<8881---0006;;@@@AAAAA;;;5556<<<?BBBBBBBBB?=:84//188:BBBBBBBBBC@@@?>>>@@@CCCCCCC<<8569==DUU^ g g g g g g g g g g g g gggggggga[[OOO[[ggggghgggggggggghhgggg`YRLLSZZgggggggghhhgggggggghXXPIIPX`hhhhhhhhhhhhhhhhhhWWFFFWW_hhhhhhhhhhhhhhhhUUMDDVV_iiiihiiiiiiiiiiUUAAAUU_iiiiiiiiiiiii^SS>>HSSiiiiiiiiiiiii]RF;;FRRiiiiiiiiiiii\PD88DPPiiiiiiiiiiiiPOB5DX t |&P&PLz))4444??????????5555,,,,666;@=;;7779<97881111889=AAAAAAAAA?<<96669<<?<<9777<<?B===999;==?BBBCCCCCCCA@@>>>8:6458<<CDDDDDDDDDDLVV^ g g g g g g ggga[[OOO[[aggggggggghgggggggggghhZYLLLYY`ghhhgggggggghhhhggg_WWHIPXXhhhhhhhhhhhhhhhhhh_WWFFNWWhhhhhhhhhhhhhhhhhUUCCCUViiiiiiiiiiiiiii_UUAAKUUiiiiiiiiiiiiiiSSH>>SS^iiiiiiiiiiiiiRR;;;RRiiiiiiiiiiii\PP888PP\iiiiiiiiiiiOOB5DY t |&P&PM?9444.))).4449?????????8220'''*226;@@AA@@@@@<899111599=AAABBBBBB<642-/149<?BBBBBBBBBB>>=999<>>@CCCCC<<8556::>?>?@ABDDDDDDDDDDEEEEEMVV[[OOO[[agggggggggggggghhggggggYYSMMSY`gggggghhhgggggggghhhXXOHHWW_hhhhhhhhhhhhhhhhhhWWNFFWW_hhhhhhhhhhhhhhhh^ULCCLU^hhhiiiiiiiiiiii_UKAAUU_iiiiiiiiiiiiiiSS>>>SSiiiiiiiiiiiii]RF;;FR]iiiiiiiiiiiiPPD88DP\iiiiiiiiiii\OB5<X l {&P&PM?????????4444))))2113666;;;@@@;666---.776@@@@@AAAAA99911127557779<<BBBB<<<6669<<?BBBBBCBBBB>>>:442118<<CCCCCCDC@@A???AAADDDDDEEE==9559==VV^gggggggggggggggghhg`YYLLRYZhhhgggggggghhhhggggg_XXIIPXWggggghhhhhhhhhhhhhhWWFFNWWhhhhhhhhhhhhhhhhhUULCCUUhhhhhhhhiiiiiiiiUUAAAUUiiiiiiiiiiiiii^SH>>HS^iiiiiiiiiiiiiRR;;;RRiiiiiiiiiiii\PP88DPPiiiiiiiiiii\OO5<D l {&P&PLx&&&2228?????:::61,.1&)))555:@@@@@@@@@<772---167<AAAAA;;863051/22:::BBBBBBBBBB<<<6669<<@BBB;<8558<8><:::>>>CCCDCCCDDDBAA@???=:8559==EEEEEEEEEEMVVggggggggggZZSMLYY`gggghhhgggggggghhhhg_WOHHPX`hhhgggggghhhhhhhhh_WNFFNW_hhhhhhhhhhhhhhhhhUUCCLUUhhhhhhhhhhhhiiiiUUAAKU_iiiiiiiiiiiiii^SH>>SS^iiiiiiiiiiii]RR;;FRRiiiiiiiiiiii\PD88PP\iiiiiiiiiiiOOB5C l s&P&PM??8222###!&+,.:<???????:555****555@@@AAA@@@@677,**,..4;;>BBBBBB>::6222:::BBBBBBBBBB<<51.+-36<CCCCCCCCC@>><::<??ACDDDDD@<<422;8<@ABBEEEEEEEEEEEEEEEEVVWYRLLSZZhgggggggghhhhggggggghXXIIHWWggghhhhhgggggghhhhhWWNFFWWhhhhhhhhhhhhhhhhh^UUCCLU^hhhhhhhhhhhhhhh^UKAAKU_iiiiiiiiiiiiiiSS>>>SSiiiiiiiiiiiii]RF;;FR]iiiiiiiiiiiiPP888PPiiiiiiiiiii\OO5<W l z&P&PM|:::6668::<222,&&&2228??@@@@@@@555/***666;@:::566;;377...388=BBBBBBBBB>::6222::>B;;8558<<?<=:777==@CCCCCCCCCC>??::;88044<<@DDEEECBBA@@ABBCEEEEEEEE<<333<<IVVhhhgggggggghhhhggg_WOHIPX`hgggggghhhhhhggggghWWFFNWWhhhhhhhhhhhhhhhhh^ULCCUU^hhhhhhhhhhhhhhh^TJ@@UUiiiiiiiiiiiiiiiSS>>HS^iiiiiiiiiiiii]RF;;RRiiiiiiiiiiii\PP88DP\iiiiiiiiiii\OB5CW rdddddd&P&PLt   (111?????????8222&&&'333@@@@@@@@@800.$#$+/3;AAAAAAAAA888///388=BBBBBBBB>331((*03:BBCCBBCCCC@==777:==CCCCCC<<832489;;=??DDEEEEEEEEEBBB@@@B>;7337<@EEEEEEEFFOWV^ggggghhhXXHHHWWghhhhhgggggghhhhhhg^VMEFNW_hhhhhhhhhhhhhhhhh^ULCCUUhhhhhhhhhhhhhhhh^TJ@@TThhiiiiiiiiiiiiiSS>>HS^iiiiiiiiiiiiiRRF;;RRiiiiiiiiiiii\PD88DP\iiiiiiiiiiiOO55C k z.b|z6*0#-!+"@e&P&PM???111*###*111????????@933-'''30055558;;A@@556+++066;AAABBBBBB888///863;5558;;BBB::6223;;>CCCCCCCCCC==:7002.08<<DDDDDDD??=;;<@@BEEEEEEE@<<21177@ABBEEEEEEEEFFGGFFFFVQRXIIPXWggggghhhhhhggggghhh_WNEEVV_hhhhhhhhhhhhhhhhhUUCCCUUhhhhhhhhhhhhhhhhTT@@@TThhhhhhiiiiiiiiiSS>>HS^iiiiiiiiiiiiiRR;;;RRiiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<W r zCa~{y~aW5(1$.!*'e&P&PL}7?????????111*###1118?@@@=::7/*-0#%'-44:AA@@@AAAA666+++666BBBBBB>;;1--.*,/88=BBBBBBBBB?;;2337;;CCCC?;;33386=777===DDDDDDDDDEB@@<<<@8:7337<@EEEEEBBA@@ABBEEEFFGGG@;6116<AWWWgggggghhhhhhggggVWNFFWWhgggghhhhhhhhhhhhhUUCCLUUhhhhhhhhhhhhhhhhTT@@@TThhhhhhhhhhiiiiiSS>>HS^iiiiiiiiiiiiiRR;;FR]iiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<W r!>`U2$0!.+)&&P&PN)$ ///7????????8111   #))3::@@@@@@@344'''-34AAAAAAAAA;660+(&2+05;;>BBBBB=88///388BBBBCCCCCC;;4--'--8;?CCCCCCD@==777:==DDDDEEE@<<1//44<>@@EEEEEEEEEEEBBA@@AC:;221;;FFFGGGGGGFNVVghhhhhhWVEENWWhhhhhgggghhhhhhhhhUUCCLU^hhhhhhhhhhhhhhhhTT@@JT^hhhhhhhhhhhhhhiSS>>HS^iiiiiiiiiiiiiRR;;FR]iiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<W r!>A6LAMAoe0"1"0!-+(I&P&PP e e eXLB6)$ '//79994446::011###*118@@@@AAAAA43-'''444AAA:;;555624+++066BBBBBBBBBB883//389>CC;;333;;8;;433;;?CCCDDDDDDD==:77:67733<<@EEEEE@@><<>@@EEEEEEEE?:://48=BDCDFFFGGGGGGFFFFFGOLLFFNV^gghhhhhhhhggghhhhhUUCCLU^hhhhhhhhhhhhhhhhTT@@JT^hhhhhhhhihhhhhhRR=>HS^iiiiiiiiiiiii]R;;FR]iiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<V q!>@5K@MAL?H;D70!1"1"/!,:&P&PP e e e e e e e e`\C=7",//?@@@@@@@@111###*229AAAAAAAA:4-(!$).5>BBBBBBBB660+++66<BBBBBBBBB801&$$.16CCCCCCCDD?;;333;<<DDDDDD?;;2-2308;>>EEEEEEEEEEE@@><<>@<:500::@FGGGEDCAAADDEGGGGGF@:5005;AGOWWgghhhhhhhhggghUUCCLU^hhhhhhhhhhhhhhhhTT@@JT^hhhhhhhhhhhhihhRR==GR]iiiiiiiiiiiii]RF;;RRiiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<V q!>?3I>L@K>F9C5>1;._T0"1#3$1#8&P&PP e e`\\XTTT\\\ e e e eLLB6) 008@@@@@@@@@122$$$222::7447::A445(((555BBBBBBBBB<66+++666::6226;;C>99///99>CCDDCCCCC?;<44415022;;?DEEEE>>;88;>>AEEEEEEEE::--+33>@@EEFGGGGGFFFDDDBBB?94//:;AGGGGGGGGGGGXX`hhhhUTBCLU^hhhhhhhhhhhhhhhh^T@@@T^hhhhhihhhhhhhhhSS>=GR]hhhhiiiiiiiii]RF;;RRiiiiiiiiiiiiiPD88PPiiiiiiiiiiiiOO5;V qc5*G;J=I<E7A3=0:,7(4%0"1#3$&P&POTTT\\\ e e e e e e e e e e e e e e e eXLC*% (008@@@@@A=:3((" &229AAAAABBB;55.((.55BBBBBBBB>4.)!#&*66BCCCCCCCC>99//05::CCCCC>;;22051448<<DEEEEEEEEE>>;88;>:::005:?EEEE@@><<@BBGGGGFFFFA;5/.97AACDEGGGGGGGGGGGHHH;;88GT^hhhhhhhhhhhhhhhh^TJ@@TThhhhhhhhhihhhhh]R==HS^hhhhhhhhiiiiiiRF;;RRiiiiiiiiiiiiiPP88DP\iiiiiiiiiiiOO5;V p$f$f#g#g, C8F:G:C6@2;.8*5'2$0"\Q2$4%n&P&PO e e e e e e e e e e e e e e e e e e e e e e e e f f f fMHC*%$,&44::=AAAA222$$$223BBBBBBBBB55.(((205222::>BBB660+,177CCCCCCCCC?::5/).**1;;?DDDDDD<<8448<<EEEEEEEE?:/+)//7>>EEEEEEEEEEEBB@>>@B7://0;;GGGGGDCDBBBDDEGGGGG:;..4;AHHGGXX`hhhhhhhhh^TJ@@TThhihhhhhhhhhhii]RG==RRhhiihhhhhhhhiiRR;;FRiiiiiiiiiiiii\P88DP\iiiiiiiiiii\OB5B p1$1$1$*D1$1$1$1$$e$e1$1$1$1$1$1$1$$f*E1$1$1$#f*E1$1$1$1$1$1$#g#g1$1$1$*F*F1$1$1$1$c9-B6E7B5>0:,7)3&1#/!. -\QbX¾¿&P&PP e e e e e e e e e e e e e e e e e e e e e e e e f f f f[[VQQUG?4*!!119AAAAAAAA922$$$+33BBBBB>::2-(0#%(55;BBBBBBBBC771,,177CCCC?;6215334/05:?DDDDDDDDEE<<8448<7:000::EEEE>>;88;>>EEEEEEGGG;;--033?BBGGGGGGFFFGGEDDBB68,-4;AHHHHHHHGHHHHHXX`^TJ@@TThhhhhhihhhhhhhh]SH>=RRhhhhhhiiihhhhh\Q;;FR]iiiiiiiiiiii\PD88P\iiiiiiiiiii\OB5B iw1$1$1$1$$e*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f*E1$1$1$1$1$1$1$1$1$*E1$1$1$1$1$1$1$1$*F*=2@3A3=/9+6(3$0". ---,e&P&PP e e e e e e e e e e e e e e e e e e e e e e_[[QQQV[[ f f e e e e f fYHC*%!111AAAAAABBB33+" '''2::>BBBBB;55(((55;BBBCCCCCC77.&&$));;DDCCCCC?::000::?DDDEEEE?:6**(,0<<@EEEEEEEEEE>>;88;>>:;005;AGGFFBB@>>@BDGGFFGGG::..38>BCCEEHHHHHHGHHHHH:3,,:DX`hhhhhhhhiihhhhRR==HSihhhhhhhhhiiih\QE::Q]iiiiiiiiiiiiiPD88PPiiiiiiiiiiiiOO5;Vw$e1$1$1$1$1$1$1$1$*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f#g1$1$1$1$1$1$1$1$1$1$1$1$*E1$1$1$*F*F1$1$1$1$.#;.>0<.8*5'2#/!. --,,,-"@&P&PP e e e e e e e e e e e e e e e e eZZUPPP[[` f f f f f f f f e e e f f f f f f fYLC6%!)11BB>::222:/1+$$+33:BBBBBBBB;55(((55<CC::5115:482--288CCCCDDDDD?::000:77500::?EEE@<<444<<@EEEEEEEEE93*(+08@CGGGGFFFGGGDBB>>>A79..4:@GGGGGHEEDCCDEEHHH::,,3:AHHHIIIIXX`hhhiiSR==GR]hhiiihhhhhhhhiRF::QQhhhiiiiiiiiii\P88DP\iiiiiiiiiii\OB;V p1$1$1$1$*D1$1$1$1$1$*D1$1$1$1$*E$f$f1$1$1$1$1$1$#f1$1$1$1$1$*E1$1$1$1$#g1$1$1$1$1$1$1$1$*Fc1&8+;-7)4&1#/ . --,,---/#&P&PP e e e e e e e e e e eZZZPPPUZZ e e e e f f f f f f f f f f e e e f f f f f f f f f e e e fG7. ))>BBBBBBBB33+$$$33BBBBBBBBB;0,"),3CCCCCDDDD882,,17>DDDDDDD::,))))1;;EEEEEEEEEE@<<448<<?93..39?EFC@@:::@@CFFGGGGGG::,*138>BBDGGGGGHHHHHHEE66))17AHHHHHHHIIIIIIIIAI?9=R]hhhhhhiiihhhhh\Q:;FR]hhhhhhiiiiii\PD88P\iiiiiiiiiiiiOB5B iv1$1$1$1$$e*D1$1$1$1$$e1$1$1$1$*E1$1$1$1$#f#g1$1$1$1$*E1$1$1$1$*E1$1$1$1$#h1$1$1$1$1$c2&5(7(3%0"/ . --,,-,- - -!ÿPE:/&P&PP e e e e e_ZZUPPUZZ_ e e e e e e e e e f f f f f f f f f f e e e f f f f f f f f`YYMNNZZ` fMH7*!)11BBBBBBBBB33+$$+33B99111::><55(((55CDDDDDDDC=77---526005:?DEEE@;6116;;EEEEEEEEE?1,%#+.6<EEEEFGGGGGC@@:99@@::..4:@GGGGDBB>>@BBGHHHHA:,,3:AFEDCCDEEHHHIIIII:2++::JJIXX`hhhhiiii\QE::Q]iiiihhhhhhiiiPP88DPiiiiiiiiiiii\O5;U o*D1$1$1$1$1$1$1$1$*D$e1$1$1$1$1$1$1$1$#f1$1$1$1$*E1$1$1$1$#g1$1$1$1$1$1$1$1$1$%/#2$3%1"/!. . --,--- - .!."aXXM>3&P&POZZUPPPZZZ e e e e e e e e e e e e e e e f f f f f f f f f f f e e f f f`ZZNNNZY_ f f f f f f f f f f fMH7*!)11BBBBBBBB9*( %*3BCCCCCCCC<5.()/66DDDCCC>:5,(2&)-88DDEEEEEEEE;;6116;@?93..99EEE<<844<=BGGGGGGGGG:6)'*/8@@GGGGGGGGGGGBB@?950),::HHHHIHHHHEEDCCDF9:++2:IIIIJJIIIIIIXYaRR;:QQhhhhiiiiihhhh[PD8DP\iiiiiiiiiiiiOB5B i*D1$1$1$1$1$1$      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrtuvxyz{|}~s*D$e1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f1$1$1$1$#g1$1$1$1$#g1$1$1$1$1$1$1$*F%, 0"0"/!/ . --- -- - -!.!/"0$1%~`UB6e&P&POZZZ e e e e e e e e f e e e e e e e e e e e e f f f f f f f f f f f_YZNNNZZ` f f f e e f f f f f f f f f f f f f f f fMH7*!)/-911199BBB33+$%,4;CCCCCCCDD66/)))0*//::DDDDD>82--399EEEEEEEEE?/+!!)/;@EEEEEEEEE@<=566>>G::..4:@GGG@@=::@@CGGGGGGG92,,77A??ACEHHIHHHHHHH@90)/6=FFGIIIIJJJIIIIA91)19NY`hhhhhiiiiihOO77PPiiiiiiiiiiii\O5;Uo1$1$1$1$1$1$$e1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f1$1$1$1$#g1$1$1$1$#g#h1$1$1$1$1$*F%*. 0!/!/ . -- - - .!.!."0#0$bYi^h^F;e&P&PP e e e e e e e e e e e f e e e e e e e e e e e e f f f f f fZZTNNNYZ` f f f f f f f f e e f f f f f f f f f f f f f f f f f fXXK812!)19BBBBBBBBC44%%%44;CCDD?:500+0%()66=DDDDDDDDD993--99?993..99EE@;;116;;EEEEEEEFFG62%#'/8>GGGGGGGGGGC@@:::@59,,29AHHHHHECC???DDEHH91**9:IIIGFFDDDFGHJJI99))99JJJJJIIIXX`ii\PD7CO[hiiiiiiiiiiiOB5B h*D1$1$1$1$1$1$*D$e1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f1$1$1$1$#g1$1$1$1$#g1$1$1$1$1$1$1$%(-0!/!/ .!. - - .!."/"0$`Wh^rhpfI?&P&PP f e e e e e e e e e e f f e e e e e e e e e e e fZZTNNTZZ` f f f f f f f f f f f f f f e f f f f f f f f f f f f fXXQKKQX_ f f f f fMC*%!119BBBCCCCC;44%*%0::?DDDDC=66))/66DDDDDEEEE3-&%-9EEEEEEEEEE;;611;;@E?93..::GG>>:66>>BGGGGGGGG@9*(+/4=@AHHHHHHHHHHHFD=2%&.4@HHIIIIIIIIIGFG<5&'/7AIIIJJJJJIIIII89(0AIihhhhiiiiiii\O5;Uo1$1$1$1$1$1$1$1$$e1$1$1$1$1$1$1$1$1$1$1$1$#f*E1$1$1$*E1$1$1$1$#g*E1$1$1$1$1$1$1$1$c',0"0!/!/!.!.!/"/"/#0$rh{qwnLB&P&PP f e e e e e e e e e e f f e e e e e e_YYMMNTZZ f f f f f f f f f f f f f f f f f f f f e f f f f f f f fXXQKKQXX f f f f f f f f f f f f f fYMC*!!22CCC>99//43/-&&-5<DDDCDDDDD66/))06=99..39?EE993--39?EEEEEEEEE@4.$ //GGGGGGGGGGB>>66:>>@92,,9@GGGG@@>;;AADHHHH@92++9@CCA??ADDIIIIIII91))98GEDDEFFJJJJJJI8/''9BKKKKJYY`iiiiOO5A ht1$1$1$1$1$*D1$1$1$1$1$1$1$1$*E1$1$1$1$*E1$1$1$*E#g1$1$1$1$*E1$1$1$1$1$1$1$1$*F1$1$1$1$*FFOF+1"0"0"0"/"0"0#]T}u{~v&&P&PP f f e e e e e e e e e f f eYYSMMMYY_ e f f f f f f f f f f f f f f f f f f f f f f f f f f f f_XXKKKXX f f f f f f f f f f f f f f f f f f f f f f f fMH4 #.9>CCCDDDD55&&&55<DDDDDDDD2+$#17EEEEEEEEEE99---99EE>82,,88E@;6227<AGGGGGGGGGG1+#!+.>BGGGGGGGGHHDAA;;/5&*99IIIHHHHHHDD@@@D=7))19AJJJJIIIFFEDDE?7''/8IIKKKKKKKJJJK8:-<n$e1$1$1$1$$e*D1$1$1$*D$e1$1$1$1$*E$f1$1$1$1$$f$f1$1$1$1$#f1$1$1$1$1$*E1$1$1$1$#g1$1$1$1$1$1$1$1$1$BxZO|}mee&P&PP f f e e e e e e_YYTNNSYY_ e e e e e e f f f f f f f f f f f f f f f f f f f f f f f_XYKKKXX_ f f f f f f f f f f f f f f f f f f f f f f f f f fWWHHHWWMD+&"22;DDDDDDDD<55&&-5193..39?DE>70**07>EEEEEEEEE?2(! ,2EEEEEFFFGG<<222<<GG99,,29GGB>>666>>GGGGHHH@91*/58;;>BEIHHHHHHIII96&&22@DDJJJJJJIIIII8/%%5<DEFFJKKKKKKKA7%*<Soooo1$1$1$1$1$1$1$1$1$*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#g1$1$1$1$1$1$1$1$1$1$1$*E#g1$1$1$1$#h#h1$1$1$1$vsq¾XP&P&PP f f eYYSMMMYYZ f f e e e e e e e e e e f f f f f f f f f f f f f f f f f f_XXKKKXY_ f f f f f f f f f f f f f f f f f f f f f f f f f f^WOHHOW^ f g g g g g g gZI7+"*33DDDDDDD>9&#/5<EEDEEEEEE77***77EE>82,,88F99---99EFFFGGGGGGA5+'/;GGGGGGGGGGB>:66:?61**99HHHHHHBB<<;AADH@91)19AIIIFDB@@BEEJI@8/'/8JJJJJFFEDEFHI88&.IRnooooooooooo$e1$1$1$1$$e$e1$1$1$*D*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#g1$1$1$1$1$1$1$1$1$*E1$1$1$1$1$1$1$1$1$#hoyvt%&P&PONNNSYY e e e e e f f f f e e e e e e e e e f f f f f f f f f f f f f_XXKKKXX_ f f f g f f f f f f f f f f f f f f f f f f f f f f fWWHHHWW f f f f f f g g g g g g g g g g g gMD7&"3-33..99DDD<55&&-55EEEEEEEEE>1&+1EEEEFEEEE?93-.4:@GG@92,,99G<<222<<GGGGGGGGG?8%%%+1??HHHHHHHHIIIEA1.!#22IIIIIIIIIIJJEE;1"#35IJJJJJJJIIIJI5-#+H[ikmnoooooooooooppppp {$e1$1$1$*D*D1$1$1$$e*E1$1$1$1$1$$f*E1$1$1$1$1$#g*E1$1$1$1$1$1$#g1$1$1$1$1$1$1$#h~{y_W&P&PO` f f e e e e e e e e f f f f e e e e e e e e e f f f f f f f f_XXKKKXX_ f f f f f f f f g f f f f f f f f f f f f f f f f f fWWOHHOW^ f f f f f f f f f f g g g g g g g g g g g g g gVV<1%%*3;DDDDDDDDE55&&&55EE>82,-88>77**077FEEEEEEEFF::% $-9GGGGGGGGGA<7227<AG81**8@HHHC?;77;?CHHHIA91(08@BB?<<BBEIIIIIJ8/''8>DD@@@EEGJJJJ@7.*<Mmmkiieegkkmoooooooppppppppppq |Bzwu{!?&P&PP f f f f e e e e e e e f f f f e e e e e e e e e f f f_XXKKKXX_ f f f f f f f f f f f f f g g f f f f f f f f f f f f^WWHHHWW f f f f f f f f f f f f f f f g g g g g g g g g gVVEEMV^ g g g gMD+&"33DDDEEEEEE=5$%0>FEEEEEEE770**77>EEE88++296:4..::@GGGGGGGGGA..%.<GGGHHHHHHHH??7713$)19IHHHIIIIEBB<<<;4/'/8JJJJIIIIGEE@@:5");Rmmmmmmmmmmmkkgggkkmooppppppppppqqqqqq |rizr|%&P&PP f f f f e e e e e e e f f f f f e e e e e eWXXKKKXX_ f f f f f f f f f f f f f f f f f f g g f f f f f f f fWWOHHWW^ f f f f f f f f f f f f f f f f f f f g g g g g^VMEEMV^ g g g g g g g g g g h gZI7&"*4<EE88,,28>55&&.65EEEEEEEEF?70&"""-8?FGGGGGG@::..4:@GG?81**8?G<<722==BHHHHHHH80(%3688<@DHHIIIIIII@8##1.<?CFJJJJIIIJJ@7%+FV^^bffmmmmmmmmooooomkkgggllnpppppppqqqqqqqqqqqrujaqhxpx%&P&PP f f f f e e e e e e e f f f f f eWWPJJJXX_ f f f f f f f f f f f f f f f f f f f f f f f g g f f f^WOHHOWW g f f f f f f f f f f f g f f f f f f f f f f f g^VMEEVV g g g g g g g g g g g g g g g h g g g g gZM2"$'>EEEEEEEE66.&&55EEEE?81**7/8***89GGGGGGGGGG::$$",8GGGGGGGGGA==338=88((08HHHIII@@777@@II8/''8@IIIJCC<<<CCII7.%.M^llllmff___ffimmmoooooooooomllhhhllnppqqqqqqqqqqqrsssss!>*@5H=PEYNaUe[k`rgxow&P&PP f f f f f e e e e e e_XXQKKPWW e e e e f f f f f f f f f f f f f f f f f f f f f f f f f_WWHHHWW f f f f f g f f f f f f f f f f f g f f f f f f f fUUDEEVV g g g g g g g g g g g g g g g g g g g h h g gTTBBKT]NE8'#44EEEEEFFEE=5-&& &88EEEEFFF882++99@GGG?81*189:4..4:@GGGGGGHHH8-"((==HHHHIIIIIIHD@-$&/<IIIIIIJJJJJFC.%1CTlllllllmmmmmiff___ghoooooooooopppplljhhjmmqqqqqqqqqrssssssssss ~%>4NDWM`Vi_si{rz|&P&PP f f f f f eWWWJJKXXX f f e e e e e e e f f f f f f f f f f f f f f f f f f f f fWWHHHWW^ f f f f f f f f f g g f f f f f f f f f f g g f f]UUDDLU^ g g g g g g g g g g g g g g g g g g g g g g gUUBBKT] g g g g g h h gZI8'#+4<FFFE77**0.1''.65EEFFFFFGG@92+")!%88GGGGGGG@::..4::G?80(08@HHB=8338>CIIII@7''/8I@@888@@IIJJJJ7.):Lkab]XXbbgllmmmmmmmmmmigdaadhhoooooppppppppplmkiikmmoqqqrssssssssssstttt ~c/$=3]Tf^ogxoy6&P&PP_XXQKKPWW^ e f f f f f f e e e e e e e f f f f f f f f f f f f f f f fWWOHHOWW f g g g g f f f f f f f f f g g f f f f f f f f f f^VMDDUU] f f f f g g g g g g g g g g g g g g g g g g gTTBBLU^ g g g g g g g g g h h g g g g gZME+%'%07>EEEEFF66&&&66FFFGG?8**104++299GGGGGGGGGG:2$&+HHHHHHHHHHH=>4432!'88IIIIIIII@@<88:3"):PkkkkklllgbbXX^ccmmmmmmmmmnooohhdaadhhppppppppppqqqqmmkiiimnpssssssssssttttttttuud!>%H>LCPGTKWO%TK{6&P&PNKXXX f f e e e e e f f f f f f f e e e e e e f f f f f f f f f f fWWOHHOWW f f f f f f g g g g f f f f f f f f f g g g f f f f fUUDDEVU f f f f f f f f f g g g g g g g g g g g g g g gTTBBKT] g h h h g g g g g g g g g h h h g g g g]SI?@D?,#+44EEEFFFFEE>6.''.'%*88GGGGGG992++99GGGG7/((7?A;5//;;AHHHHHHH7/'!2344>>CIIIIIIII@7"$C=QW^^kkkkllllllllcc^YY^chmmmnnoooooooohhabbiilpppppqqqqqqqqqmmljjjnnpsssstttttttttuuuuuuu &P&PP f f f f f f e e e e e f f f f f f f e e e e e e f f f f f fWWOHHOWW f f f f f f f f f f f g g g g f f f f f f f f f g g g^ULDDLU] f g g g f f f f f f f f f g g g g g g g g g g]TKBBKT] g g g g g h h h g g g g g g g g g h h h gSI??SS g h h hhgMI8'#44FFFFEF>7)$''''/7?GGGGGGGGG@92&! +7GGGGHHHHA;;//5;B7.&/8@IIIIC>9449>CI@7%)G]kkkk^^WQQ^^elllllllmmmmhccYYYcdnooooooooooopliibbbiimqqqqqqqqqqrssspnnjjjnnqttttttttuuuuuuuuuuuvv&P&PP f f f f f f f e e e e f f f f f f f f e e e e e fWWOHHOWW f f f f f f f f f f f f f f f f g g g g g f f f f f f fUVEEDUU f f f f f f g g g f f f f f f f f f g g g g g g]TKBBKT] g g g g g g g g g h h h h g g g g g g g gTT@?IS] g g g g h h hhgggggZI8'#1-0))7>FFGGG77''/7?GGGGG77((3/9++29@GHHHHHHHH?* $;<IIIIIIIIIII>5';Mjjjkkkkkkkkd^^RRX__lllmmmmmmmmmhc_Z[`eeoooooooppppppliibbbiiqqqqqqrsssssssspnokkkooqtttuuuuuuuuuuuvvwwwww &P&PP f f f f f f f e e e e f f f f f f f f eVVNGHOWW f f f f f f f f f f f f f f f f f f f f f g g g g g f f]ULDDMVV g g f f f f f f f f g g g g f f f f f f f f g g]TKBBTT g g g g g g g g g g g g g g h h h h g g g gSS??JT^ h g g g g g g g h h hhhggggggRR5+' #+4=FFGGGGGGG77'''.&((7?GGGGGG99++299HH?7&&77II;;500<<IIIII7.%-K\YZRKKZ[ckkkkkkkkkll__XRR``fmmmmmmmmmnnoee`[[eejoopppppppppqqiiebbeiiqrsssssssssssttqookkkoppuuuuuuuuuvvwwwwwwwwwww &P&PP f f f f f f f f e e e f f f^WWOHGNVV e f f f f f f f f f f f f f f f f f f f f f f f f f g g gVVEDDUU f f f g g g g f f f f f f f f g g g g f f f f f f]TKBBTT g g g g g g g g g g g g g g g g g g h h h h]SI??S] g h h h h g g g g g g g h h hhhgg\RG=GR]hhhgME+#,5>GGGGGG?7(&&''77GGGGGGGGGH99!!(?HHIIIHHHIB<600*'!-K\iiiiijjbZ[LLS[ckkkkklllllle``SSY``mmmmnnnooooojee[[[eepppppppqqqqqqqiiebcgkksssssssttttttttqopnllnppuuuuvvwwwwwwwwwwwxxxxxx&P&PP f f f f f f f f e]VWHHHOWW f f e e e e f f f f f f f f f f f f f f f f f f f f f f fUUMEEMV^ f f f f f f f g g g g g f f f f f f f g g g g f fTTBBBTT g g g g g g g g g g g g g g g g g g g g g g^TJ@@SS g g g g g h h h h h g g g g g g h h hhRR==RRghhhhhhgggggNF,$,52/((7?GGGG?7/''77GGGGG7.&&7892++9:IIHHHIII7.%3CEENWWiiijjjjjkkk[[LLL[[klllllllmmmm``SSS``gnnooooooooooee`[[`eeppqqqqqqqqqqqrkkgddgkkssttttttttttuuuuppnllnqqtwwwwwwwwwwwxxxxxxxyyyyy&P&PP f f f fWWOHGGVW^ f f f f f f f e e e e f f f f f f f f f f f f f f f f f f]UUDDDUV g g g g g f f f f f f f g g g g g f f f f f f f g gTTBBKTT f f f g g g g g g g g g g g g g g g g g g g]SI?@TT h h g g g g g g g h h h h h g g g g g g]R==GR\gggghhhhhhhgggggh\Q1'(55GGGGGGGGG?7/'"&%!.7HHHHHHH@:3,,39A7.%9JiiiiiWWEEEWWjjjjkkkkkkkc[SLL\\dlllmmmmmmmmf`ZTTZaaoooooooooppppee[[\ffkqqqqqqqqrssssskkgddhlltttttttuuuuuuuuupqqnnnrrrwwwwwxxxxxxxxyyyyyyyyyyz&P&POWHHHOWW^ f e e f f f f f f f f f f e e e f f f f f f f f f f f f f fUUDDDUU] f f f g g g g g g g f f f f f f g g g g g f f f f]TTBBKT] f f f f f f f g g g g g g g g g g g g g g g]SI??SS g h h h h h h g g g g g g h h h h h g g gRG==RRhhhggggghhhhhhhgggPP::QQhhhNF,($55GGGGGG>6&!%.((08@HHHHHHIIIA(""2S]hiiiiiiiii`WNEEWWakkkkkkkkkkd\\LLT]]mmmmmmmmmmnnaaTTTaahooooppppppppkff\\\ffqqqrrssssssssssllheehllttuuuuuuuuuuuvwwtrrnnnprrxxxxxxxxyyyyyyyyyyzzzzz{{&P&POWW f f f f f f f e e f f f f f f f f f f e e e f f f f f f f f fUULDDLU] f f f f f f f f g g g g g g g f f f f f f g g g g g]TKBBTT] g g g g g f f f f f f g g g g g g g g g g g gSS??IS] g g g g h h h h h h g g g g g g h h h hRR==GR g h h hhhhhgggghhhhhhhPE::P\hhhhhhhhhh[J9($516&&6>GGGHH88((08@HHI7.(9MghSS??IT^iiiiiiiijj`WNFFOXakkkkkklllll\]MMM]]mmmmmnnnnooohaZTTZabppppppppqqqqqffa\\aghsssssssssstttttllheeimmuuuuuuuuvwwwwwwwwrrpooossuxxyyyyyyyyyyzzzz{{{{{{|||&P&PP f f f f f f f f f f e f f f f f f f f f f e e e f f f fUULDDLUU f f f f f f f f f f f f f g g g g g g g g f f f f f gTTBBBTT f f f f g g g g g g f f f f f f g g g g g g g gSS??IS] g g g g g g g g h h h h h h g g g g g g]RG=GR\ g g g g h h hhhhhgggghhh\Q::EPggghhhhhhhhhhhhhhO<'55GGGGHHHHHH88(3MgggghhhhiTT???TTiiijjjjjjkkXXFFOXXkkllllllmmme]UMMU]ennnnooooooooaaTUUbbippqqqqqqqqqqqggb^^chmsssssttttttttttmmiffimmuuuwwwwwwwwwwwwxxussooorttvyyyyyyzzzz{{{{{{|||||||||&P&PP f f f f f f f f f f e f f f f f f f f f f f eTULDDLUU f f f f f f f f f f f f f f f f f f g g g g g g g g f]TTBBKTT g g g f f f f f g g g g g g f f f f f f g g g gSS??IS] g g g g g g g g g g g g h h h h h h h g gRG==RR h h h h g g g g h h hhhhhggggQE::Q\hhgggghhhhhhhhhhhOC7CO[hh[J9($56HHHHH?6$(8BP999PPghhhhiiiii^TI??TUjjjjjkkkkkkXXFFFYYllllmmmmmmmm]]MNV^^ooooooooooopibbUU[ccqqqqqqqqqrrrsmhh^^^hhnttttttttttuuuuummiffjoowwwwwwwwwxxxxxxxxxttrppptttyzzzz{{{{{{||||||||||}}}}} &P&PtPPPPPPPPPPPPPPPPPPPPONNNNNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPOMMMMOPPPPPPPPPPPPPPPPPPPPPPPPPPMMMMOPPPPPPPPPPPPPPPPPPPPPPPMMMMPPPPPPPPPPPPPPPPPPPPPNMMMNPPPPPPPPPPPPPPPPPPNLLLPPPPPPPPPPNL{LwLwLwMMLwLwLwLPPPPPPMMMMMPPPPPPPPPPPPNMMMMPPPPPPPPPPPPPNMMMMPPPPPPPPPPPPPPNNNNNPPPPPPPPPPPPPPPNNNNNOOOOOOOOOOOOOOOOONNNNNOOOOOOOOOOOOOOOOOONNNNNOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P?<99993331065339:<<>@@@@@><<<:8888<<=?AAAAAAAAAA???=884468;<AABBBBBBBBBBBBBBTTT f f f f f f f f fa]]XTTX]] f f f f f f f f f f f f g g g g g g g g g f f g g g\\WRRW\\gggggggggggfggggggggggga[[OOO[[agghgggggggggghgggggggYYSMMZZahhhhhhhhhhhhhhhhhhhXXPIIPXXhhhhhhhhhhhhhhhhhhWWFFFWW`iiihhhiiiiiiiiihVVMDDVV_iiiiiiiiiiiiiiiUUKAAKU_iiiiiiiiiiiiiiSSH>>HSSiiiiiiiiiiiii]RR;;;RR]iiiiiiiiiiii\PP889PPPiiiiiijjjiiiOOO56EZ o ~&P&PM77000007777;???=;;98887678BM6(: R  &P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&PM77;?????????74444:::=@@@@@@@@@@><<=9999===?><=:899==?@???=<<>???BBBBBBBBBBBBBBBCKQNUTTTX]] f f f f f f f f f f f f f f f f f g g g g g g g g g\[WRRW\\ggggggggggggggggggggggga[[OOO[[aggggggghgggggggggghhgYYRLLRYZhhhhhhhhhhhhhhhhhhh`XXIIIXXhhhhhhhhhhhhhhhhhhWWNFFNW_iiiiiiiihhhiiiii_VMDCMVViiiiiiiiiiiiiiiUUKAAKUUiiiiiiiiiiiiiiSSH>>HSSiiiiiiiiiiiii]RR;;;RR]iiiiiiiiiiiiPPD888PP\ijiiiiiiiii]PPB5DY n }&P&PM??????;7754-,++.444;????@@@@@@=:::44447:::@@@@@@AAAA:88411359==?BBBBBBBBAA???>===???@BBBBB<<<777==@CKTTT f f f f f f f f f f f f f f f f f g g g g\\WRRW\\ g ggggggggggggggggggggggg[[UOOU[aghgggggggggghgggggggg`ZZMLRYYggggghhhhhhhhhhhhhhhXXIIIXX`hhhhhhhhhhhhhhhhh_WWFFNWWhhhhhiiiiiiiiihh_VVDDDVViiiiiiiiiiiiiii_UUAAAUUiiiiiiiiiiiiii^SH>>HSSiiiiiiiiiiiii]RR;;;RR]iiiiiiiiiiiiPPD88DPPiiiiiiijjiiiOOO5<E n v }&P&PL{55547;9888;;;??777700004888<@@@@@@@@@@:::74447877:88:<<>AAA?===999;===BBBABBBBBB@???=776445<=@CCCCCCCCCCCCCTTT f f f f f f f f f f\\WRRW\\ g g g g g g gggggggggggggggggg[[UOOU[[gggggghgggggggggghhgg`YYLLLZZaggggggggghhhhhhhhhh`XPIIPXXhhhhhhhhhhhhhhhhhhWWNFFWW_hhhhhhhhhiiiiiiiVVLCDMV_iiiiiiiiiiiiiiiUUKAAUU_iiiiiiiiiiiii^SS>>>SS^iiiiiiiiiiii]RR;;;RR]iiiiiiiiiiiiPPD88DPPiiiiiiiiiiiiPPB5<Y m }&P&PL~////))),0555:??????????88881111888<@@A@@@;;9722741558;;;AAABBBBBBB===;999===?BB?<<9779<:??==>>@@@CCCCCCCCCCCCCCCCTTN[VQQV\\ g g g g g g g g g g g ggggggggggggg[[UOOU[[hgggggggggghggggggggggZZSLLRY`ggghhhgggggggghhhhh`XXIIIXXhhhhhhhhhhhhhhhhhh_WNFFNWWhhhhhhhhhhhhhhii_VVDDMVVhiiiiiiiiiiiiii_UKAAKUUiiiiiiiiiiiiiiSSH>>HS^iiiiiiiiiiiiiRRF;;RR]iiiiiiiiiiiiPPD88DPPiiiiiiijiiiiOOB5DY u }&P&PM=???????5555,,,,0555:???@@@@@@<8881---0006;;@@@AAAAA;;;5556<<<?BBBBBBBBB?=:84//188:BBBBBBBBBC@@@?>>>@@@CCCCCCC<<8569==DUU^ g g g g g g g g g g g g gggggggga[[OOO[[ggggghgggggggggghhgggg`YRLLSZZgggggggghhhgggggggghXXPIIPX`hhhhhhhhhhhhhhhhhhWWFFFWW_hhhhhhhhhhhhhhhhUUMDDVV_iiiihiiiiiiiiiiUUAAAUU_iiiiiiiiiiiii^SS>>HSSiiiiiiiiiiiii]RF;;FRRiiiiiiiiiiii\PD88DPPiiiiiiiiiiiiPOB5DX t |&P&PLz))4444??????????5555,,,,666;@=;;7779<97881111889=AAAAAAAAA?<<96669<<?<<9777<<?B===999;==?BBBCCCCCCCA@@>>>8:6458<<CDDDDDDDDDDLVV^ g g g g g g ggga[[OOO[[aggggggggghgggggggggghhZYLLLYY`ghhhgggggggghhhhggg_WWHIPXXhhhhhhhhhhhhhhhhhh_WWFFNWWhhhhhhhhhhhhhhhhhUUCCCUViiiiiiiiiiiiiii_UUAAKUUiiiiiiiiiiiiiiSSH>>SS^iiiiiiiiiiiiiRR;;;RRiiiiiiiiiiii\PP888PP\iiiiiiiiiiiOOB5DY t |&P&PM?9444.))).4449?????????8220'''*226;@@AA@@@@@<899111599=AAABBBBBB<642-/149<?BBBBBBBBBB>>=999<>>@CCCCC<<8556::>?>?@ABDDDDDDDDDDEEEEEMVV[[OOO[[agggggggggggggghhggggggYYSMMSY`gggggghhhgggggggghhhXXOHHWW_hhhhhhhhhhhhhhhhhhWWNFFWW_hhhhhhhhhhhhhhhh^ULCCLU^hhhiiiiiiiiiiii_UKAAUU_iiiiiiiiiiiiiiSS>>>SSiiiiiiiiiiiii]RF;;FR]iiiiiiiiiiiiPPD88DP\iiiiiiiiiii\OB5<X l {&P&PM?????????4444))))2113666;;;@@@;666---.776@@@@@AAAAA99911127557779<<BBBB<<<6669<<?BBBBBCBBBB>>>:442118<<CCCCCCDC@@A???AAADDDDDEEE==9559==VV^gggggggggggggggghhg`YYLLRYZhhhgggggggghhhhggggg_XXIIPXWggggghhhhhhhhhhhhhhWWFFNWWhhhhhhhhhhhhhhhhhUULCCUUhhhhhhhhiiiiiiiiUUAAAUUiiiiiiiiiiiiii^SH>>HS^iiiiiiiiiiiiiRR;;;RRiiiiiiiiiiii\PP88DPPiiiiiiiiiii\OO5<D l {&P&PLx&&&2228?????:::61,.1&)))555:@@@@@@@@@<772---167<AAAAA;;863051/22:::BBBBBBBBBB<<<6669<<@BBB;<8558<8><:::>>>CCCDCCCDDDBAA@???=:8559==EEEEEEEEEEMVVggggggggggZZSMLYY`gggghhhgggggggghhhhg_WOHHPX`hhhgggggghhhhhhhhh_WNFFNW_hhhhhhhhhhhhhhhhhUUCCLUUhhhhhhhhhhhhiiiiUUAAKU_iiiiiiiiiiiiii^SH>>SS^iiiiiiiiiiii]RR;;FRRiiiiiiiiiiii\PD88PP\iiiiiiiiiiiOOB5C l s&P&PM??8222###!&+,.:<???????:555****555@@@AAA@@@@677,**,..4;;>BBBBBB>::6222:::BBBBBBBBBB<<51.+-36<CCCCCCCCC@>><::<??ACDDDDD@<<422;8<@ABBEEEEEEEEEEEEEEEEVVWYRLLSZZhgggggggghhhhggggggghXXIIHWWggghhhhhgggggghhhhhWWNFFWWhhhhhhhhhhhhhhhhh^UUCCLU^hhhhhhhhhhhhhhh^UKAAKU_iiiiiiiiiiiiiiSS>>>SSiiiiiiiiiiiii]RF;;FR]iiiiiiiiiiiiPP888PPiiiiiiiiiii\OO5<W l z&P&PM|:::6668::<222,&&&2228??@@@@@@@555/***666;@:::566;;377...388=BBBBBBBBB>::6222::>B;;8558<<?<=:777==@CCCCCCCCCC>??::;88044<<@DDEEECBBA@@ABBCEEEEEEEE<<333<<IVVhhhgggggggghhhhggg_WOHIPX`hgggggghhhhhhggggghWWFFNWWhhhhhhhhhhhhhhhhh^ULCCUU^hhhhhhhhhhhhhhh^TJ@@UUiiiiiiiiiiiiiiiSS>>HS^iiiiiiiiiiiii]RF;;RRiiiiiiiiiiii\PP88DP\iiiiiiiiiii\OB5CW rdddddd&P&PLt   (111?????????8222&&&'333@@@@@@@@@800.$#$+/3;AAAAAAAAA888///388=BBBBBBBB>331((*03:BBCCBBCCCC@==777:==CCCCCC<<832489;;=??DDEEEEEEEEEBBB@@@B>;7337<@EEEEEEEFFOWV^ggggghhhXXHHHWWghhhhhgggggghhhhhhg^VMEFNW_hhhhhhhhhhhhhhhhh^ULCCUUhhhhhhhhhhhhhhhh^TJ@@TThhiiiiiiiiiiiiiSS>>HS^iiiiiiiiiiiiiRRF;;RRiiiiiiiiiiii\PD88DP\iiiiiiiiiiiOO55C k z.b|z6*0#-!+"@e&P&PM???111*###*111????????@933-'''30055558;;A@@556+++066;AAABBBBBB888///863;5558;;BBB::6223;;>CCCCCCCCCC==:7002.08<<DDDDDDD??=;;<@@BEEEEEEE@<<21177@ABBEEEEEEEEFFGGFFFFVQRXIIPXWggggghhhhhhggggghhh_WNEEVV_hhhhhhhhhhhhhhhhhUUCCCUUhhhhhhhhhhhhhhhhTT@@@TThhhhhhiiiiiiiiiSS>>HS^iiiiiiiiiiiiiRR;;;RRiiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<W r zCa~{y~aW5(1$.!*'e&P&PL}7?????????111*###1118?@@@=::7/*-0#%'-44:AA@@@AAAA666+++666BBBBBB>;;1--.*,/88=BBBBBBBBB?;;2337;;CCCC?;;33386=777===DDDDDDDDDEB@@<<<@8:7337<@EEEEEBBA@@ABBEEEFFGGG@;6116<AWWWgggggghhhhhhggggVWNFFWWhgggghhhhhhhhhhhhhUUCCLUUhhhhhhhhhhhhhhhhTT@@@TThhhhhhhhhhiiiiiSS>>HS^iiiiiiiiiiiiiRR;;FR]iiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<W r!>`U2$0!.+)&&P&PN)$ ///7????????8111   #))3::@@@@@@@344'''-34AAAAAAAAA;660+(&2+05;;>BBBBB=88///388BBBBCCCCCC;;4--'--8;?CCCCCCD@==777:==DDDDEEE@<<1//44<>@@EEEEEEEEEEEBBA@@AC:;221;;FFFGGGGGGFNVVghhhhhhWVEENWWhhhhhgggghhhhhhhhhUUCCLU^hhhhhhhhhhhhhhhhTT@@JT^hhhhhhhhhhhhhhiSS>>HS^iiiiiiiiiiiiiRR;;FR]iiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<W r!>A6LAMAoe0"1"0!-+(I&P&PP e e eXLB6)$ '//79994446::011###*118@@@@AAAAA43-'''444AAA:;;555624+++066BBBBBBBBBB883//389>CC;;333;;8;;433;;?CCCDDDDDDD==:77:67733<<@EEEEE@@><<>@@EEEEEEEE?:://48=BDCDFFFGGGGGGFFFFFGOLLFFNV^gghhhhhhhhggghhhhhUUCCLU^hhhhhhhhhhhhhhhhTT@@JT^hhhhhhhhihhhhhhRR=>HS^iiiiiiiiiiiii]R;;FR]iiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<V q!>@5K@MAL?H;D70!1"1"/!,:&P&PP e e e e e e e e`\C=7",//?@@@@@@@@111###*229AAAAAAAA:4-(!$).5>BBBBBBBB660+++66<BBBBBBBBB801&$$.16CCCCCCCDD?;;333;<<DDDDDD?;;2-2308;>>EEEEEEEEEEE@@><<>@<:500::@FGGGEDCAAADDEGGGGGF@:5005;AGOWWgghhhhhhhhggghUUCCLU^hhhhhhhhhhhhhhhhTT@@JT^hhhhhhhhhhhhihhRR==GR]iiiiiiiiiiiii]RF;;RRiiiiiiiiiiii\PD88PPiiiiiiiiiiiiOO5<V q!>?3I>L@K>F9C5>1;._T0"1#3$1#8&P&PP e e`\\XTTT\\\ e e e eLLB6) 008@@@@@@@@@122$$$222::7447::A445(((555BBBBBBBBB<66+++666::6226;;C>99///99>CCDDCCCCC?;<44415022;;?DEEEE>>;88;>>AEEEEEEEE::--+33>@@EEFGGGGGFFFDDDBBB?94//:;AGGGGGGGGGGGXX`hhhhUTBCLU^hhhhhhhhhhhhhhhh^T@@@T^hhhhhihhhhhhhhhSS>=GR]hhhhiiiiiiiii]RF;;RRiiiiiiiiiiiiiPD88PPiiiiiiiiiiiiOO5;V qc5*G;J=I<E7A3=0:,7(4%0"1#3$&P&POTTT\\\ e e e e e e e e e e e e e e e eXLC*% (008@@@@@A=:3((" &229AAAAABBB;55.((.55BBBBBBBB>4.)!#&*66BCCCCCCCC>99//05::CCCCC>;;22051448<<DEEEEEEEEE>>;88;>:::005:?EEEE@@><<@BBGGGGFFFFA;5/.97AACDEGGGGGGGGGGGHHH;;88GT^hhhhhhhhhhhhhhhh^TJ@@TThhhhhhhhhihhhhh]R==HS^hhhhhhhhiiiiiiRF;;RRiiiiiiiiiiiiiPP88DP\iiiiiiiiiiiOO5;V p$f$f#g#g, C8F:G:C6@2;.8*5'2$0"\Q2$4%n&P&PO e e e e e e e e e e e e e e e e e e e e e e e e f f f fMHC*%$,&44::=AAAA222$$$223BBBBBBBBB55.(((205222::>BBB660+,177CCCCCCCCC?::5/).**1;;?DDDDDD<<8448<<EEEEEEEE?:/+)//7>>EEEEEEEEEEEBB@>>@B7://0;;GGGGGDCDBBBDDEGGGGG:;..4;AHHGGXX`hhhhhhhhh^TJ@@TThhihhhhhhhhhhii]RG==RRhhiihhhhhhhhiiRR;;FRiiiiiiiiiiiii\P88DP\iiiiiiiiiii\OB5B p1$1$1$*D1$1$1$1$$e$e1$1$1$1$1$1$1$$f*E1$1$1$#f*E1$1$1$1$1$1$#g#g1$1$1$*F*F1$1$1$1$c9-B6E7B5>0:,7)3&1#/!. -\QbX¾¿&P&PP e e e e e e e e e e e e e e e e e e e e e e e e f f f f[[VQQUG?4*!!119AAAAAAAA922$$$+33BBBBB>::2-(0#%(55;BBBBBBBBC771,,177CCCC?;6215334/05:?DDDDDDDDEE<<8448<7:000::EEEE>>;88;>>EEEEEEGGG;;--033?BBGGGGGGFFFGGEDDBB68,-4;AHHHHHHHGHHHHHXX`^TJ@@TThhhhhhihhhhhhhh]SH>=RRhhhhhhiiihhhhh\Q;;FR]iiiiiiiiiiii\PD88P\iiiiiiiiiii\OB5B iw1$1$1$1$$e*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f*E1$1$1$1$1$1$1$1$1$*E1$1$1$1$1$1$1$1$*F*=2@3A3=/9+6(3$0". ---,e&P&PP e e e e e e e e e e e e e e e e e e e e e e_[[QQQV[[ f f e e e e f fYHC*%!111AAAAAABBB33+" '''2::>BBBBB;55(((55;BBBCCCCCC77.&&$));;DDCCCCC?::000::?DDDEEEE?:6**(,0<<@EEEEEEEEEE>>;88;>>:;005;AGGFFBB@>>@BDGGFFGGG::..38>BCCEEHHHHHHGHHHHH:3,,:DX`hhhhhhhhiihhhhRR==HSihhhhhhhhhiiih\QE::Q]iiiiiiiiiiiiiPD88PPiiiiiiiiiiiiOO5;Vw$e1$1$1$1$1$1$1$1$*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f#g1$1$1$1$1$1$1$1$1$1$1$1$*E1$1$1$*F*F1$1$1$1$.#;.>0<.8*5'2#/!. --,,,-"@&P&PP e e e e e e e e e e e e e e e e eZZUPPP[[` f f f f f f f f e e e f f f f f f fYLC6%!)11BB>::222:/1+$$+33:BBBBBBBB;55(((55<CC::5115:482--288CCCCDDDDD?::000:77500::?EEE@<<444<<@EEEEEEEEE93*(+08@CGGGGFFFGGGDBB>>>A79..4:@GGGGGHEEDCCDEEHHH::,,3:AHHHIIIIXX`hhhiiSR==GR]hhiiihhhhhhhhiRF::QQhhhiiiiiiiiii\P88DP\iiiiiiiiiii\OB;V p1$1$1$1$*D1$1$1$1$1$*D1$1$1$1$*E$f$f1$1$1$1$1$1$#f1$1$1$1$1$*E1$1$1$1$#g1$1$1$1$1$1$1$1$*Fc1&8+;-7)4&1#/ . --,,---/#&P&PP e e e e e e e e e e eZZZPPPUZZ e e e e f f f f f f f f f f e e e f f f f f f f f f e e e fG7. ))>BBBBBBBB33+$$$33BBBBBBBBB;0,"),3CCCCCDDDD882,,17>DDDDDDD::,))))1;;EEEEEEEEEE@<<448<<?93..39?EFC@@:::@@CFFGGGGGG::,*138>BBDGGGGGHHHHHHEE66))17AHHHHHHHIIIIIIIIAI?9=R]hhhhhhiiihhhhh\Q:;FR]hhhhhhiiiiii\PD88P\iiiiiiiiiiiiOB5B iv1$1$1$1$$e*D1$1$1$1$$e1$1$1$1$*E1$1$1$1$#f#g1$1$1$1$*E1$1$1$1$*E1$1$1$1$#h1$1$1$1$1$c2&5(7(3%0"/ . --,,-,- - -!ÿPE:/&P&PP e e e e e_ZZUPPUZZ_ e e e e e e e e e f f f f f f f f f f e e e f f f f f f f f`YYMNNZZ` fMH7*!)11BBBBBBBBB33+$$+33B99111::><55(((55CDDDDDDDC=77---526005:?DEEE@;6116;;EEEEEEEEE?1,%#+.6<EEEEFGGGGGC@@:99@@::..4:@GGGGDBB>>@BBGHHHHA:,,3:AFEDCCDEEHHHIIIII:2++::JJIXX`hhhhiiii\QE::Q]iiiihhhhhhiiiPP88DPiiiiiiiiiiii\O5;U o*D1$1$1$1$1$1$1$1$*D$e1$1$1$1$1$1$1$1$#f1$1$1$1$*E1$1$1$1$#g1$1$1$1$1$1$1$1$1$%/#2$3%1"/!. . --,--- - .!."aXXM>3&P&POZZUPPPZZZ e e e e e e e e e e e e e e e f f f f f f f f f f f e e f f f`ZZNNNZY_ f f f f f f f f f f fMH7*!)11BBBBBBBB9*( %*3BCCCCCCCC<5.()/66DDDCCC>:5,(2&)-88DDEEEEEEEE;;6116;@?93..99EEE<<844<=BGGGGGGGGG:6)'*/8@@GGGGGGGGGGGBB@?950),::HHHHIHHHHEEDCCDF9:++2:IIIIJJIIIIIIXYaRR;:QQhhhhiiiiihhhh[PD8DP\iiiiiiiiiiiiOB5B i*D1$1$1$1$1$1$*D$e1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f1$1$1$1$#g1$1$1$1$#g1$1$1$1$1$1$1$*F%, 0"0"/!/ . --- -- - -!.!/"0$1%~`UB6e&P&POZZZ e e e e e e e e f e e e e e e e e e e e e f f f f f f f f f f f_YZNNNZZ` f f f e e f f f f f f f f f f f f f f f fMH7*!)/-911199BBB33+$%,4;CCCCCCCDD66/)))0*//::DDDDD>82--399EEEEEEEEE?/+!!)/;@EEEEEEEEE@<=566>>G::..4:@GGG@@=::@@CGGGGGGG92,,77A??ACEHHIHHHHHHH@90)/6=FFGIIIIJJJIIIIA91)19NY`hhhhhiiiiihOO77PPiiiiiiiiiiii\O5;Uo1$1$1$1$1$1$$e1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f1$1$1$1$#g1$1$1$1$#g#h1$1$1$1$1$*F%*. 0!/!/ . -- - - .!.!."0#0$bYi^h^F;e&P&PP e e e e e e e e e e e f e e e e e e e e e e e e f f f f f fZZTNNNYZ` f f f f f f f f e e f f f f f f f f f f f f f f f f f fXXK812!)19BBBBBBBBC44%%%44;CCDD?:500+0%()66=DDDDDDDDD993--99?993..99EE@;;116;;EEEEEEEFFG62%#'/8>GGGGGGGGGGC@@:::@59,,29AHHHHHECC???DDEHH91**9:IIIGFFDDDFGHJJI99))99JJJJJIIIXX`ii\PD7CO[hiiiiiiiiiiiOB5B h*D1$1$1$1$1$1$*D$e1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#f1$1$1$1$#g1$1$1$1$#g1$1$1$1$1$1$1$%(-0!/!/ .!. - - .!."/"0$`Wh^rhpfI?&P&PP f e e e e e e e e e e f f e e e e e e e e e e e fZZTNNTZZ` f f f f f f f f f f f f f f e f f f f f f f f f f f f fXXQKKQX_ f f f f fMC*%!119BBBCCCCC;44%*%0::?DDDDC=66))/66DDDDDEEEE3-&%-9EEEEEEEEEE;;611;;@E?93..::GG>>:66>>BGGGGGGGG@9*(+/4=@AHHHHHHHHHHHFD=2%&.4@HHIIIIIIIIIGFG<5&'/7AIIIJJJJJIIIII89(0AIihhhhiiiiiii\O5;Uo1$1$1$1$1$1$1$1$$e1$1$1$1$1$1$1$1$1$1$1$1$#f*E1$1$1$*E1$1$1$1$#g*E1$1$1$1$1$1$1$1$c',0"0!/!/!.!.!/"/"/#0$rh{qwnLB&P&PP f e e e e e e e e e e f f e e e e e e_YYMMNTZZ f f f f f f f f f f f f f f f f f f f f e f f f f f f f fXXQKKQXX f f f f f f f f f f f f f fYMC*!!22CCC>99//43/-&&-5<DDDCDDDDD66/))06=99..39?EE993--39?EEEEEEEEE@4.$ //GGGGGGGGGGB>>66:>>@92,,9@GGGG@@>;;AADHHHH@92++9@CCA??ADDIIIIIII91))98GEDDEFFJJJJJJI8/''9BKKKKJYY`iiiiOO5A ht1$1$1$1$1$*D1$1$1$1$1$1$1$1$*E1$1$1$1$*E1$1$1$*E#g1$1$1$1$*E1$1$1$1$1$1$1$1$*F1$1$1$1$*FFOF+1"0"0"0"/"0"0#]T}u{~v&&P&PP f f e e e e e e e e e f f eYYSMMMYY_ e f f f f f f f f f f f f f f f f f f f f f f f f f f f f_XXKKKXX f f f f f f f f f f f f f f f f f f f f f f f fMH4 #.9>CCCDDDD55&&&55<DDDDDDDD2+$#17EEEEEEEEEE99---99EE>82,,88E@;6227<AGGGGGGGGGG1+#!+.>BGGGGGGGGHHDAA;;/5&*99IIIHHHHHHDD@@@D=7))19AJJJJIIIFFEDDE?7''/8IIKKKKKKKJJJK8:-<n$e1$1$1$1$$e*D1$1$1$*D$e1$1$1$1$*E$f1$1$1$1$$f$f1$1$1$1$#f1$1$1$1$1$*E1$1$1$1$#g1$1$1$1$1$1$1$1$1$BxZO|}mee&P&PP f f e e e e e e_YYTNNSYY_ e e e e e e f f f f f f f f f f f f f f f f f f f f f f f_XYKKKXX_ f f f f f f f f f f f f f f f f f f f f f f f f f fWWHHHWWMD+&"22;DDDDDDDD<55&&-5193..39?DE>70**07>EEEEEEEEE?2(! ,2EEEEEFFFGG<<222<<GG99,,29GGB>>666>>GGGGHHH@91*/58;;>BEIHHHHHHIII96&&22@DDJJJJJJIIIII8/%%5<DEFFJKKKKKKKA7%*<Soooo1$1$1$1$1$1$1$1$1$*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#g1$1$1$1$1$1$1$1$1$1$1$*E#g1$1$1$1$#h#h1$1$1$1$vsq¾XP&P&PP f f eYYSMMMYYZ f f e e e e e e e e e e f f f f f f f f f f f f f f f f f f_XXKKKXY_ f f f f f f f f f f f f f f f f f f f f f f f f f f^WOHHOW^ f g g g g g g gZI7+"*33DDDDDDD>9&#/5<EEDEEEEEE77***77EE>82,,88F99---99EFFFGGGGGGA5+'/;GGGGGGGGGGB>:66:?61**99HHHHHHBB<<;AADH@91)19AIIIFDB@@BEEJI@8/'/8JJJJJFFEDEFHI88&.IRnooooooooooo$e1$1$1$1$$e$e1$1$1$*D*D1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$#g1$1$1$1$1$1$1$1$1$*E1$1$1$1$1$1$1$1$1$#hoyvt%      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVcYZ[\]^_`abefgirklmnopqdstu~wxyz{|}h&P&PONNNSYY e e e e e f f f f e e e e e e e e e f f f f f f f f f f f f f_XXKKKXX_ f f f g f f f f f f f f f f f f f f f f f f f f f f fWWHHHWW f f f f f f g g g g g g g g g g g gMD7&"3-33..99DDD<55&&-55EEEEEEEEE>1&+1EEEEFEEEE?93-.4:@GG@92,,99G<<222<<GGGGGGGGG?8%%%+1??HHHHHHHHIIIEA1.!#22IIIIIIIIIIJJEE;1"#35IJJJJJJJIIIJI5-#+H[ikmnoooooooooooppppp {$e1$1$1$*D*D1$1$1$$e*E1$1$1$1$1$$f*E1$1$1$1$1$#g*E1$1$1$1$1$1$#g1$1$1$1$1$1$1$#h~{y_W&P&PO` f f e e e e e e e e f f f f e e e e e e e e e f f f f f f f f_XXKKKXX_ f f f f f f f f g f f f f f f f f f f f f f f f f f fWWOHHOW^ f f f f f f f f f f g g g g g g g g g g g g g gVV<1%%*3;DDDDDDDDE55&&&55EE>82,-88>77**077FEEEEEEEFF::% $-9GGGGGGGGGA<7227<AG81**8@HHHC?;77;?CHHHIA91(08@BB?<<BBEIIIIIJ8/''8>DD@@@EEGJJJJ@7.*<Mmmkiieegkkmoooooooppppppppppq |Bzwu{!?&P&PP f f f f e e e e e e e f f f f e e e e e e e e e f f f_XXKKKXX_ f f f f f f f f f f f f f g g f f f f f f f f f f f f^WWHHHWW f f f f f f f f f f f f f f f g g g g g g g g g gVVEEMV^ g g g gMD+&"33DDDEEEEEE=5$%0>FEEEEEEE770**77>EEE88++296:4..::@GGGGGGGGGA..%.<GGGHHHHHHHH??7713$)19IHHHIIIIEBB<<<;4/'/8JJJJIIIIGEE@@:5");Rmmmmmmmmmmmkkgggkkmooppppppppppqqqqqq |rizr|%&P&PP f f f f e e e e e e e f f f f f e e e e e eWXXKKKXX_ f f f f f f f f f f f f f f f f f f g g f f f f f f f fWWOHHWW^ f f f f f f f f f f f f f f f f f f f g g g g g^VMEEMV^ g g g g g g g g g g h gZI7&"*4<EE88,,28>55&&.65EEEEEEEEF?70&"""-8?FGGGGGG@::..4:@GG?81**8?G<<722==BHHHHHHH80(%3688<@DHHIIIIIII@8##1.<?CFJJJJIIIJJ@7%+FV^^bffmmmmmmmmooooomkkgggllnpppppppqqqqqqqqqqqrujaqhxpx%&P&PP f f f f e e e e e e e f f f f f eWWPJJJXX_ f f f f f f f f f f f f f f f f f f f f f f f g g f f f^WOHHOWW g f f f f f f f f f f f g f f f f f f f f f f f g^VMEEVV g g g g g g g g g g g g g g g h g g g g gZM2"$'>EEEEEEEE66.&&55EEEE?81**7/8***89GGGGGGGGGG::$$",8GGGGGGGGGA==338=88((08HHHIII@@777@@II8/''8@IIIJCC<<<CCII7.%.M^llllmff___ffimmmoooooooooomllhhhllnppqqqqqqqqqqqrsssss!>*@5H=PEYNaUe[k`rgxow&P&PP f f f f f e e e e e e_XXQKKPWW e e e e f f f f f f f f f f f f f f f f f f f f f f f f f_WWHHHWW f f f f f g f f f f f f f f f f f g f f f f f f f fUUDEEVV g g g g g g g g g g g g g g g g g g g h h g gTTBBKT]NE8'#44EEEEEFFEE=5-&& &88EEEEFFF882++99@GGG?81*189:4..4:@GGGGGGHHH8-"((==HHHHIIIIIIHD@-$&/<IIIIIIJJJJJFC.%1CTlllllllmmmmmiff___ghoooooooooopppplljhhjmmqqqqqqqqqrssssssssss ~%>4NDWM`Vi_si{rz|&P&PP f f f f f eWWWJJKXXX f f e e e e e e e f f f f f f f f f f f f f f f f f f f f fWWHHHWW^ f f f f f f f f f g g f f f f f f f f f f g g f f]UUDDLU^ g g g g g g g g g g g g g g g g g g g g g g gUUBBKT] g g g g g h h gZI8'#+4<FFFE77**0.1''.65EEFFFFFGG@92+")!%88GGGGGGG@::..4::G?80(08@HHB=8338>CIIII@7''/8I@@888@@IIJJJJ7.):Lkab]XXbbgllmmmmmmmmmmigdaadhhoooooppppppppplmkiikmmoqqqrssssssssssstttt ~c/$=3]Tf^ogxoy6&P&PP_XXQKKPWW^ e f f f f f f e e e e e e e f f f f f f f f f f f f f f f fWWOHHOWW f g g g g f f f f f f f f f g g f f f f f f f f f f^VMDDUU] f f f f g g g g g g g g g g g g g g g g g g gTTBBLU^ g g g g g g g g g h h g g g g gZME+%'%07>EEEEFF66&&&66FFFGG?8**104++299GGGGGGGGGG:2$&+HHHHHHHHHHH=>4432!'88IIIIIIII@@<88:3"):PkkkkklllgbbXX^ccmmmmmmmmmnooohhdaadhhppppppppppqqqqmmkiiimnpssssssssssttttttttuud!>%H>LCPGTKWO%TK{6&P&PNKXXX f f e e e e e f f f f f f f e e e e e e f f f f f f f f f f fWWOHHOWW f f f f f f g g g g f f f f f f f f f g g g f f f f fUUDDEVU f f f f f f f f f g g g g g g g g g g g g g g gTTBBKT] g h h h g g g g g g g g g h h h g g g g]SI?@D?,#+44EEEFFFFEE>6.''.'%*88GGGGGG992++99GGGG7/((7?A;5//;;AHHHHHHH7/'!2344>>CIIIIIIII@7"$C=QW^^kkkkllllllllcc^YY^chmmmnnoooooooohhabbiilpppppqqqqqqqqqmmljjjnnpsssstttttttttuuuuuuu &P&PP f f f f f f e e e e e f f f f f f f e e e e e e f f f f f fWWOHHOWW f f f f f f f f f f f g g g g f f f f f f f f f g g g^ULDDLU] f g g g f f f f f f f f f g g g g g g g g g g]TKBBKT] g g g g g h h h g g g g g g g g g h h h gSI??SS g h h hhgMI8'#44FFFFEF>7)$''''/7?GGGGGGGGG@92&! +7GGGGHHHHA;;//5;B7.&/8@IIIIC>9449>CI@7%)G]kkkk^^WQQ^^elllllllmmmmhccYYYcdnooooooooooopliibbbiimqqqqqqqqqqrssspnnjjjnnqttttttttuuuuuuuuuuuvv&P&PP f f f f f f f e e e e f f f f f f f f e e e e e fWWOHHOWW f f f f f f f f f f f f f f f f g g g g g f f f f f f fUVEEDUU f f f f f f g g g f f f f f f f f f g g g g g g]TKBBKT] g g g g g g g g g h h h h g g g g g g g gTT@?IS] g g g g h h hhgggggZI8'#1-0))7>FFGGG77''/7?GGGGG77((3/9++29@GHHHHHHHH?* $;<IIIIIIIIIII>5';Mjjjkkkkkkkkd^^RRX__lllmmmmmmmmmhc_Z[`eeoooooooppppppliibbbiiqqqqqqrsssssssspnokkkooqtttuuuuuuuuuuuvvwwwww &P&PP f f f f f f f e e e e f f f f f f f f eVVNGHOWW f f f f f f f f f f f f f f f f f f f f f g g g g g f f]ULDDMVV g g f f f f f f f f g g g g f f f f f f f f g g]TKBBTT g g g g g g g g g g g g g g h h h h g g g gSS??JT^ h g g g g g g g h h hhhggggggRR5+' #+4=FFGGGGGGG77'''.&((7?GGGGGG99++299HH?7&&77II;;500<<IIIII7.%-K\YZRKKZ[ckkkkkkkkkll__XRR``fmmmmmmmmmnnoee`[[eejoopppppppppqqiiebbeiiqrsssssssssssttqookkkoppuuuuuuuuuvvwwwwwwwwwww &P&PP f f f f f f f f e e e f f f^WWOHGNVV e f f f f f f f f f f f f f f f f f f f f f f f f f g g gVVEDDUU f f f g g g g f f f f f f f f g g g g f f f f f f]TKBBTT g g g g g g g g g g g g g g g g g g h h h h]SI??S] g h h h h g g g g g g g h h hhhgg\RG=GR]hhhgME+#,5>GGGGGG?7(&&''77GGGGGGGGGH99!!(?HHIIIHHHIB<600*'!-K\iiiiijjbZ[LLS[ckkkkklllllle``SSY``mmmmnnnooooojee[[[eepppppppqqqqqqqiiebcgkksssssssttttttttqopnllnppuuuuvvwwwwwwwwwwwxxxxxx&P&PP f f f f f f f f e]VWHHHOWW f f e e e e f f f f f f f f f f f f f f f f f f f f f f fUUMEEMV^ f f f f f f f g g g g g f f f f f f f g g g g f fTTBBBTT g g g g g g g g g g g g g g g g g g g g g g^TJ@@SS g g g g g h h h h h g g g g g g h h hhRR==RRghhhhhhgggggNF,$,52/((7?GGGG?7/''77GGGGG7.&&7892++9:IIHHHIII7.%3CEENWWiiijjjjjkkk[[LLL[[klllllllmmmm``SSS``gnnooooooooooee`[[`eeppqqqqqqqqqqqrkkgddgkkssttttttttttuuuuppnllnqqtwwwwwwwwwwwxxxxxxxyyyyy&P&PP f f f fWWOHGGVW^ f f f f f f f e e e e f f f f f f f f f f f f f f f f f f]UUDDDUV g g g g g f f f f f f f g g g g g f f f f f f f g gTTBBKTT f f f g g g g g g g g g g g g g g g g g g g]SI?@TT h h g g g g g g g h h h h h g g g g g g]R==GR\gggghhhhhhhgggggh\Q1'(55GGGGGGGGG?7/'"&%!.7HHHHHHH@:3,,39A7.%9JiiiiiWWEEEWWjjjjkkkkkkkc[SLL\\dlllmmmmmmmmf`ZTTZaaoooooooooppppee[[\ffkqqqqqqqqrssssskkgddhlltttttttuuuuuuuuupqqnnnrrrwwwwwxxxxxxxxyyyyyyyyyyz&P&POWHHHOWW^ f e e f f f f f f f f f f e e e f f f f f f f f f f f f f fUUDDDUU] f f f g g g g g g g f f f f f f g g g g g f f f f]TTBBKT] f f f f f f f g g g g g g g g g g g g g g g]SI??SS g h h h h h h g g g g g g h h h h h g g gRG==RRhhhggggghhhhhhhgggPP::QQhhhNF,($55GGGGGG>6&!%.((08@HHHHHHIIIA(""2S]hiiiiiiiii`WNEEWWakkkkkkkkkkd\\LLT]]mmmmmmmmmmnnaaTTTaahooooppppppppkff\\\ffqqqrrssssssssssllheehllttuuuuuuuuuuuvwwtrrnnnprrxxxxxxxxyyyyyyyyyyzzzzz{{&P&POWW f f f f f f f e e f f f f f f f f f f e e e f f f f f f f f fUULDDLU] f f f f f f f f g g g g g g g f f f f f f g g g g g]TKBBTT] g g g g g f f f f f f g g g g g g g g g g g gSS??IS] g g g g h h h h h h g g g g g g h h h hRR==GR g h h hhhhhgggghhhhhhhPE::P\hhhhhhhhhh[J9($516&&6>GGGHH88((08@HHI7.(9MghSS??IT^iiiiiiiijj`WNFFOXakkkkkklllll\]MMM]]mmmmmnnnnooohaZTTZabppppppppqqqqqffa\\aghsssssssssstttttllheeimmuuuuuuuuvwwwwwwwwrrpooossuxxyyyyyyyyyyzzzz{{{{{{|||&P&PP f f f f f f f f f f e f f f f f f f f f f e e e f f f fUULDDLUU f f f f f f f f f f f f f g g g g g g g g f f f f f gTTBBBTT f f f f g g g g g g f f f f f f g g g g g g g gSS??IS] g g g g g g g g h h h h h h g g g g g g]RG=GR\ g g g g h h hhhhhgggghhh\Q::EPggghhhhhhhhhhhhhhO<'55GGGGHHHHHH88(3MgggghhhhiTT???TTiiijjjjjjkkXXFFOXXkkllllllmmme]UMMU]ennnnooooooooaaTUUbbippqqqqqqqqqqqggb^^chmsssssttttttttttmmiffimmuuuwwwwwwwwwwwwxxussooorttvyyyyyyzzzz{{{{{{|||||||||&P&PP f f f f f f f f f f e f f f f f f f f f f f eTULDDLUU f f f f f f f f f f f f f f f f f f g g g g g g g g f]TTBBKTT g g g f f f f f g g g g g g f f f f f f g g g gSS??IS] g g g g g g g g g g g g h h h h h h h g gRG==RR h h h h g g g g h h hhhhhggggQE::Q\hhgggghhhhhhhhhhhOC7CO[hh[J9($56HHHHH?6$(8BP999PPghhhhiiiii^TI??TUjjjjjkkkkkkXXFFFYYllllmmmmmmmm]]MNV^^ooooooooooopibbUU[ccqqqqqqqqqrrrsmhh^^^hhnttttttttttuuuuummiffjoowwwwwwwwwxxxxxxxxxttrppptttyzzzz{{{{{{||||||||||}}}}} &P&PtPPPPPPPPPPPPPPPPPPPPONNNNNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPOMMMMOPPPPPPPPPPPPPPPPPPPPPPPPPPMMMMOPPPPPPPPPPPPPPPPPPPPPPPMMMMPPPPPPPPPPPPPPPPPPPPPNMMMNPPPPPPPPPPPPPPPPPPNLLLPPPPPPPPPPNL{LwLwLwMMLwLwLwLPPPPPPMMMMMPPPPPPPPPPPPNMMMMPPPPPPPPPPPPPNMMMMPPPPPPPPPPPPPPNNNNNPPPPPPPPPPPPPPPNNNNNOOOOOOOOOOOOOOOOONNNNNOOOOOOOOOOOOOOOOOONNNNNOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P C1A5G=F C1A5GH_> C1A5G=F C1A5GHd C1A5G=F C1A5GH C1A5G=F C1A5GH JFIFddDuckyAdobed   #%'%#//33//@@@@@@@@@@@@@@@&&0##0+.'''.+550055@@?@@@@@@@@@@@@8" !1Ast5QaqT"42B#Rbr3S!21Q"Aa ?v9 }>ћ9|ަ n˿jӬH "J }˺?s 6kfb+?5׾>|s5FɏQ<[<>enesgS6ѽ/˶{N6Wm~>ӟxy0}Ɨr={wi?h\M-L4景f2i>_*5o[r]u̘s=XwM3/h-霻:Ā@r  $WsBR#{sKrFL+cͷ-iD:~]ј/]&b>k-U8hxVjΓ4ޝ&?;^v[/ċu'1pة$z7mkM:On8goO֮ϵ\}Qqi\mX'Su?bW ]"i[kfm4;vL^y?.Ź9\|2_拝o^&qu6C_M;=N7s] E+~ѧXhq#E H;ޢ n'ctmWFb@e."H $H_i-BNoQo7Hߵti$Z|dHr H$T$H#H$@ szx179ӛ[ѹ]u"kx"~*6N 2〗[ I 9ՎX jȿ),Q+IJyI3tC?M PL $tGfctNw=7soڽ4b$CF9J!O3r Yy4/\L5K\W-> cZ&b⩭ux+5ѯtd~a{,zFXgcc4 ntW\}|D>@ uP44JPFH! SDClN]&eb"4dZ""4tֺ*fz ^CL;^}kG@ߵ{$h0$ b'LV01ͥŊ+vʵk ^%%%*`PximX"xڱ32Q9̾}nC\<,ʩNmD&4Z&5Az#1zX&Q/\^C)[arVнe>H0eZrB_0e^8g.`=X]L=?VXsZaa]wFf_> mAѾٗϷnX@#Řnex HZ ʓf%cǡ&h z%}tJۦ誋WuhY ˣ/o6lFϷj׬HLmz[S5RbbuEyYha~fZZaxr% ,+XpR{'=v>n$L0N;Gr4  ǣ/o懣/o>ݫ_ ">Nx4tf&ǓIV5KW!c[3b˹X^Zax>(C{aYq[;y)?@ADFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkmopqrsw{|~   wwww www'wwwwwx ( @wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxwwwwwwxwwwwxxwpwwxwwwwwwwwxwwwww'wwwwwxwwwwwwwwwwwxwwwwwwxwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww ( @  xwwwwywwywwwa???}Z[\]^_`abcdefghijklmnopq C1A5G<?N=><~;U=@HDED/;rD'C7CrD,!@HDED;9BE)$@HLE(A7BDAhE0B Pyu Ȉ Pyh0載YÐÐD$jP43D$jP3jh8dPd%D$(L$(D$3L$D$D$ D$T$,L$RD$$(D$PNL$d (Ðjh[dPd% $0L$D$3L$D$ D$D$L$$( h@L$Vhx@L$Hh`@L$:T$ R谂$$3d 0QVFPD$3FF F^YÐjh{dPd% $0L$D$3L$D$ D$D$L$$(T$ R $$3d 0 Pyu Ȉ Pyh0茇YÐSVW|$u3 PL!؋tjh@P% u _^[Ëjh@Q u _^[Ëjh@R u _^[Ëjh@P u _^[Ëjh@Q u _^[Ëjh@Vx u _^[Ëjh@DZPU _$^[ÐUjhdPd%SV\W3P3uDž\ u Džll3;lj}tH];t0S F6$VWjSjjf ujjW tBMjWQ ;t/}t&U RW tЅu EuW MPd _^[]S\$u[U- VWjjjSjjՋNVjT!t VWjSjjՍD$|$PL$QP!F_^]w$3[ø[ø[Ð \U$hVU u h@U, $hV-}^]\SW|$ V󫍄$lP2$p3+T$dT$d3@+уOʍT$d+O͍D$PL$$T$hQjjj jjjRj( _t,D$ jP$ 3ۋ[^]\h@Vt3ۋ[^]\djhPd%pSV$V u hAV, $V3ۃ;}^[$pd |;D$UW3|$8V󫍄$PL$/$L$3IT$|QRL$\$\$ \$$/@3T$!$I+‹;w|;vAL$S,1L$Ut+T$D$ξ@<ʃD$l$($3T$!I+‹;wB|;vCL$S,1L$Uqt-T$D$΋$<ʃD$l$(D$_;]u!L$ T$0QRSSj SSSPS( tD$ jP$ \$L$ ;t1A:t |$t6?"u h$AV, W=0 VV |0"th$AV_^ÐVFtH@t ȈAUUU ][;ujT][E w;sj8SVt$W}ȋŃM_]^ ][D$Vt$FtH@t hDD$j L$$PQjVbpP,{ T$lPhBR׃D$hP$UL$D$QSVRptAUh(DD$j L$PQSVRoPz PD$phBP׃L$hQ3tVo$l_^][d hjhadPd%SUVW@3$)Ƅ$(f$<=d!P$,hFQ׋ R0ol$ D$$(P3QUDŽ$@\$ otVD$;tPnhET$j D$R$4PQU\$,nPy T$(PhBR׃D$$PL$SQntT$$8RhG$8L$PQL$lƄ$j$<Ƅ$T$D$h;D$L$L$UQ3%D$;u]VRT^^ L$ 3DYu_Huu 5uuL$Y;t VT^[ ÐSVWh H33ۋFtN+;sGRWmW FPjjjP hH_^[ÃVh@HpL$VD$j PQ^ PhGhGP ^(D$SUVL$8Wj PQ\^ T$$PhGhGRd!l$PP ~D$$WVPhGWVhGVӍWQhGVWUhGVӍ WRhpGVӍWPh|GVӋWL$j QR] PhdGVӋWD$j PQ] PhTGVӋWT$j RP\ Ph\GVӊ HGuTHWPhLGVӋ$WL$j QRI] Ph@GVWjjj_^][( SVWh(}\3҃;t@؉ $ \$T$ڋFN ~+\$ ;t +w;u3+;‰D$}3UR[؋FSWPL$QUiHVURWFNPQ7VR~QD$ N :TD$]V^_^[ Ë+sTWRPW+FL$ Q+׹+QP<N;t[T$ ;uF_F^[ PPPNA;tP;ljuO;t T$ ;uF_F^[ ÐAÐVWjaPD$ PjVLPVhQLPtVP_^L$3ɈHHH Qu3ËA+ÐSUVW|$FN V++l$t +wu3+D$}3RY^;߉D$tSUOF;uD$ PU7FNUQWTVFRPNQLO|$ T$΍F l$Llj~N_^][+sBOQPWF\$ й+S+QPN;tI;uBD$t$(t$,t$0tP $_^]d [ÐD$SUVW|$M33uuu IكvAM;t%Atnt-Et&ȈAUUU ][;uj脹][E w;sjhSVt$W}ȋŃM_]^ ][QD$ SUVt$WL$u ;AQ;+;+׋yT$;skfPEL$ffREf;tF;sCօt=D$ L$PQVC tT$+T:~T$럋L$_^Q]+[Y !_^][Y SًL$UCVWuL$;sq_^][ ;w_+L$;sK|$fPZDfQfMDf;uT$RWVB t;stNƋK_^]+[ !_^][ SVW|$v1F3;t*H:t#t;_H^^^ ^2[L$;uV:tA;t,H@:t_^Vt P ^ÐjhhdPd%SUVWl$EMu3ۋ;ˉ\$,D$tPD$PȋD$;u:N;u3QRkF uT$HF^ RFΉ@(;t$D$SPL$T$ QR19|$u܋FP%^^ L$35*uHuu 5uuL$*;t Vr%E;tH@:t F_^[L$d ÉvvL$_^[d ÐD$uH;t H;uÐjhdPd%QSUVt$ Wt$3;l$|$(nnn !QUW_W^D$kkk G !;s;u'QUjj_^][L$d 3;vU;uQG;u!xs?sss G;u!COKW S H_^]H[L$d jUt);!t{͋UȃL$_^][d ÐSUVL$WE;sQu3;tRFtK;|.NF;} HЋ;|:;΋t P;Pu9D$;u_^][YË˃@L$L$}+ŋq+‹T;} ;|;Ë| ;|;}֋׋\$Ë>9}~9|x;}x;|;v 8>뵋Ë++$;jSV! t$ VU +݃@$\$t$n@;ti;tbT$;|,~F;}/ω HЃ;|;֋t H;‰Hu;u\$;t97OG׋;} HЃ;|2;u_^][YÐ Pyu Ȉ Pyh0\YÐD$Ul$+ŋȃ@SVWT$}r+‹T;} ;|;Ë| ;|;}֋׋\$Ë>9}~9|x;}x;|;v 8>뵋Ë++$;jSV1 t$ VU +ŋЃ@$_^[]Ð Pyu Ȉ Pyh0,YÐ%!%!%!%|!%!%t!%p!%l!%x!%!%!%!%!%!%!%!t$Yø0EVjMEׅ!V|YPVM!eEPMEh0PE!^QQSVEWPuEu)]e~ jψ`5!jSoM!_^[d Au!UQMgEhP1PX/QVu!ejN MM^d VD$tVY^(QS]VWSuC e ~ jψ耄5!jSM!_^[d <yQVu!ejN 2M`M^d UQM*Eh0PHVD$tVY^Vt$!!^P0EVjME諃"VPYPVMeEPMEh2PE"^dQVu!ejN JMxM^d UQM*Eh2P`VD$tVY^Vt$9"^UE S]VW9CsCM +9usu;u5!Vu jyv?;u;Cu!xs)jrCu!GKOK O @6jV蘂t(Cu!M VPwG w$0_^[] SVt$ W9ws7蹑G\$+;s؅v2O+PPQw +jVt Gw$_^[Pyu PyQyu Qy h0>Yh2YáuSVWj_;uhuZuu5jhu uS h5Y=u%;u=u=uu j 9=uuS _^[jhu u hu Ã=uu hu Vi5ԌԌY Ќ+;s=RP5Ԍ] u3, Ќ+ ԌԌ ЌD$Ќ^t$yYHhYԌu jԌY ԌЌUQSVWE EddE] cm_^[XY$XY$UQQSVWdEEju uuwE @$M Ad]d_^[USVWE3PPPuuuu u| E_^[E]UE eMEEEB@MEdE썅duQuM$ȋEdUE jPppjup u ]U4SVWeEEEE EEEE EeeeeEemdE؍dEEEЋEEԍEPE0k$PhYYe}td]؉d EdE_^[USVWE@ftE @$jXMjE pE pE pjuE p u E x$u uu ] ck cjX_^[]UQSV} W}w _ƉuE|9u$MN9L};H~u EM Eu} }ʋEMF1M;G w;v$_^[USVWUjjh(ut]_^[]ËL$AtD$T$SVWD$Pjh0d5d%D$ Xp t.;t$$t(4v L$H |uhD@Td _^[3d y0uQ R 9QuSQH SQHMKCk Y[Q=L$r-=s+ȋą@Pjt$YYU} u }}jj juu uE ]U}M SVWt u-Au3uƋ3u vW0Awڀ!IIG;r_^[]U3} u9E}jXPuu uE ]UWVu M};v;xur)$8Ǻr $P$H$̟`#ъFGFGr$8I#ъFGr$8#ъFGr$8I/ DDDDDDDDDDDDDD$8HP\pE^_ÐE^_ÐFGE^_ÍIFGFGE^_Ðt1|9u$r $С$IǺr +$ؠ$С0F#шGNOr$СIF#шGFGr$СF#шGFGFGZ$СIǡDDDDDDDDD D DDDD$С E^_ÐFGE^_ÍIFGFGE^_ÐFGFGFGE^_̋D$ StJT$3ۊ\$ t B2tlHt.urWߋ_t B2t>Hu[Ãr 3˿~3σtJ2t#2t2t 2t_B[ÍB_[ÍB_[ÍB_[U =SVWuu u^'YYlj u YMFEAEfAEMtW9u3kjE5jPjuS5Č$ uf}f}fEEEu ffFEu tS>u3ajE5jPjuS5Č$ ufuuCfufEE E$<uff;uft-u MjYjf;YH jY3_^[SUVW|$= M~jP&YY KAtG7G-t+u7G3ۃ= M~ jVY&YY Kpt \F7Gσ-u_^][t$lYÃ|$ SUVW8=ut$t$t$& jRL$ l$T$YfBtG u3T3Bًf;=rf;=w=1f;=r(f;=w=$<uffEEtHMu3T3Eًf;5rf;5w51f;5r(f;5w5$<uff;u$ftD$L$jY3_^][jYf;HS39vuD$f=ar]f=zwW[VWV 9= tVjYj[t$YD$t j%YVfD$_^[UQEf=uf Ã=vuf=arTf=zwNf=sjP (YYufEjEjPEjPh5v%fEtfEVt$WF @tf V(VV) _^Vt$WF t4Vs*V*v*) }Ft PfYf _^UVuS(uuu uu(^]UQSVW} }]υ}Mu3ufF tFE EMfF t*Ft#;ȋrW6SU)})~> ߋ}K;Mr.}t 3u+PSv]+ t6t7)EVh*Yt(FCME}vE_^[ÃN N 3+Eu V.u^WVt$t$t$'-Vq'_^j@t$ t$ ËD$ ju6Yt3;u,9 u~ u9 $vuI=0<6 uQYjX US]Vu W}u =u&tu"t WVSЅt WVSu3NWVS6E u u7WPStu&WVSu!E } ttWVSЉE E _^[] ut u=uur6t$6hHYYUjh("hdPd%SVWutyu;j ~YeV7YEt VP8YYM}Qj YÃuSj >YEEPEPVD E܅tPuu6E M }uu j UYVj5pyT Md _^[VD$tVUY^VW|$ D"7@PAYFYt 7PIYYF_^VW|$ D"GFt%w@PYFYtwPhIYYGF_^yD"t qYËAuL"Vjd"vYtV3YjIY^VD$tVfY^̋L$tAt@u~Ѓ3ƒtAt2t$tt͍AL$+ÍAL$+ÍAL$+ÍAL$+jPdPD$ d%l$ l$ PU EVWjYh"}EE EEPuuu _^UWVu M};v;xur)$Ǻr $$$ Lp#ъFGFGr$I#ъFGr$#ъFGr$IܮԮ̮ĮDDDDDDDDDDDDDD$0E^_ÐE^_ÐFGE^_ÍIFGFGE^_Ðt1|9u$r $$@IǺr +$$ȯF#шGNOr$IF#шGFGr$F#шGFGFGZ$IDLT\dltDDDDDDDDD D DDDD$̰E^_ÐFGE^_ÍIFGFGE^_ÐFGFGFGE^_á،th@@h,@h(@h@jjt$  jjj Wj_9=(vut$ P |$ S\$=$v vu<Ԍt" ЌVq;rtЃ;5Ԍs^hL@hD@CYYhX@hP@2YY[t_t$=(v _j Yj YVt$;t$ s tЃ^Ujh"hdPd%(SVW]3;uu Yu ;u SYty9}܃j Y}S0YE;;5lywLVSPn8 t]8V3YE;t*CHE;rPSuS.0ESPO09}uK;uj^u u VW5pyX E;t#CHE;rPSuSu/MZ9}u";uj^u VSW5py E܋E;9=wVDYu ]3j VYÃGw;vj^u }܃j YEEPEPSw< }Ѕ;5qs\SWuu@tEE8S<YE܅t*E;rPuunWuu`<]}uSVj5pyX E܅t=E;rPSu'Wuu<VSj5py E܃M&E;uf9=wt^VBYKu ]j Y33w;uj^VSW5py ;u9=wt VlBYu3Md _^[Ujh"hdPd%SVWtyuFj $YeuV-YEt v uuM }Uuj HYÃuFj YEEPEPu: E؅t 0uuM-}uuj5py ƋMd _^[Ëuj Y5wt$YYÃ|$w"t$Yu9D$tt$2AYu3Ujh"hdPd% SVWtyuCu;5lyj YeV/YEM Etmj  YÃuZEtpj^u;5qw.j YEP9YEM Eu-Vuj YËEujX$Pj5pyX Md _^[UVuW 9>tI E@ft~to}uijVuu V~ tP8csmu,9xv'HItU$Ru uVuuu Pу u uu$Vuuu P jX_^]UE e@E|M;A| SVucsmW 9K~ub9~u]~uW xl&pl@pjVEE2?YYu= 9~u9~u ~u 9~9~}EPEPWu u؋E;E9;|;{wCEC E~dF@ xE~v7u= uM9EME}$uu$u S7uuuuu V ,}Ei}t jVqYY_^[À}u u$u uuuuu V UQQVWxht!u$u uuuu uus}EPEPWu uE;EsO;>|C;~>F NHtyu&ju$u VjPuuuu u ,E_^VW|$ GtJxPtAt$N;tQR#<YYu"ttD$tt t u3jX_^Ujh"hdPd% SVWe]su};utU~;w|eGDt hSPpMu/YËeM}]uG4u릉sMd _^[ËD$8csmt3U} S]VW} tu SWu},uuWu,u$6uuWFhu(@Gs uuWu,tWPN_^[]Ujh"hdPd%SVWe]]ԃeu FE5@lE*@pE}xlMHpeEu uSuVEԃeM:EԋMd _^[unYËeejEPYY3ϋu }E؉FMHlMHp?csmu)u# u}u}tPWYYËD$8csmuxux u xujX3Ujh"hdPd% SVWeMAuxkA`U | etDujv:YY0jW$:YYFMQPYYutR]js9YYjW9YYvsW ~V뗃~]jsu:v9YYjW9YYt~vVsYYPW f<9YYtVjWJ9YYtHvX9Yt;tjFPsYYPvWFPsYYPvWMMd _^[jXËeqUjh#hdPd%QQSVWeEtHIteQp1MMd _^[38E Ëe L$Vt$Qƅ| 42I ^USQE EEUuMm:VW_^]MUuQ]Y[ V# 0It:jtj8YYt)V50I tV4Y NjX^3^0ItP  0IËD$@Pq@VW!50I!u?jtj}7YYt&V50I tVY NjYW!_^á0IVt$u P!tlF$tPYF(tPYF0tPYF8tPYF@tPYFDtPYFP=qtPYVYj50I ^Ujh#hdPd%QQSVWe3u9p`tEP`u jXËeeMw7Ujh0#hdPd%QQSVWee4ItEjXËeeMISVD$ uL$D$3؋D$ Aȋ\$T$D$ ud$ȋD$r;T$wr;D$ vN3ҋ^[SD$ uL$D$ 3D$3Pȋ\$T$ D$ ud$d$r;T$ wr;D$v+D$T$+D$T$ ؃[V5 5I5tI5dI5DI^VW= @It+It#tItdItDIt P6rYJ